Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate WP_011382581.1 AMB_RS00675 KR domain-containing protein
Query= metacyc::MONOMER-11802 (255 letters) >NCBI__GCF_000009985.1:WP_011382581.1 Length = 238 Score = 87.0 bits (214), Expect = 3e-22 Identities = 83/254 (32%), Positives = 114/254 (44%), Gaps = 32/254 (12%) Query: 3 IANKHFIVSGAASGLGAATAQMLVEAGAKVMLVDLN--AQAVEAKARELGDNARFAVADI 60 +A K +V+G G+GAA A L+ GAKVM+ + D A A Sbjct: 4 LAGKLALVTGGTRGIGAAIAARLLADGAKVMVTGTRPGGEGPAGSGYLAVDFADAAATTA 63 Query: 61 SDEQAAQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGL---ASFAKVINVNLIG 117 EQAA VD LVN AGI K P A FA++ VN+ Sbjct: 64 FAEQAAGLGVDI----------LVNNAGI-------NKVSPFAEIDPADFARIQQVNVTA 106 Query: 118 SFNLLRLAAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAAR 177 F L R M A G I+ +SI + G+ AY+ASK A+ LT A Sbjct: 107 PFLLARAVVPGMQAKAW------GRIVTVSSIWGRISRAGRGAYSASKFAVDGLTAALAA 160 Query: 178 ELARFGIRVMTIAPGIFETPMMAG-MSDEVRASLAAGVPFPPRLGRPQEYAALARHII-- 234 E+A+FGI +APG +T + + ++ L A VP RLGRP+E AA + Sbjct: 161 EVAQFGILANCVAPGFIDTELTRQVLGEDGIKELTAQVP-ARRLGRPEEIAAFVAWLAGP 219 Query: 235 ENSMLNGEVIRLDG 248 ENS ++G+ + +DG Sbjct: 220 ENSYISGQNLVIDG 233 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 238 Length adjustment: 24 Effective length of query: 231 Effective length of database: 214 Effective search space: 49434 Effective search space used: 49434 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory