Align NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_011384082.1 AMB_RS08465 ABC transporter ATP-binding protein
Query= TCDB::Q7A2H0 (260 letters) >NCBI__GCF_000009985.1:WP_011384082.1 Length = 253 Score = 182 bits (463), Expect = 5e-51 Identities = 97/254 (38%), Positives = 149/254 (58%), Gaps = 7/254 (2%) Query: 9 LPLLAASGLCKSFGGIKAVQEARIEVAQGSITGLIGPNGAGKTTLFNLLSNFIRPDKGRV 68 + LL L K FGG+ AV++ V G I +IGPNGAGKTTLFNL++ P GRV Sbjct: 1 MSLLKVEKLSKEFGGVHAVEDLTFSVEAGHIHSIIGPNGAGKTTLFNLITGVYTPSSGRV 60 Query: 69 IFDGEPIQQLQPHQIAQQGMVRTFQVARTLSRLSVLENMLLAAQKQTGENFWQVQLQPQV 128 +F + ++P+++A+ GM RTFQ + + +EN+++ F L+ Sbjct: 61 LFQDRLVSGMKPYELAELGMSRTFQNLQIFFNMQAIENVMVGHHLHLDRRFLPSLLRLPK 120 Query: 129 VVKEEKQLQEQAMFLLESVGLAKKAYEYAGGLSGGQRKLLEMGRALMTNPKLILLDEPAA 188 V + +++ +E L+E VGL K A + G K LE+ RAL PKL+LLDEPAA Sbjct: 121 VTRRDRECREYCAGLMEFVGLGKYLDADAASMPYGALKRLEIARALAAQPKLLLLDEPAA 180 Query: 189 GVN---PRLIDDICDRILTWNRQDGMTFLIIEHNMDVIMSLCDRVWVLAEGQNLADGTPA 245 G+N R ID++ ++ T G+T +++EH+M ++M + D++ L G+ LA+GTPA Sbjct: 181 GLNATESREIDEVIKKVAT----TGVTVVLVEHDMKMVMGISDQITALDYGRKLAEGTPA 236 Query: 246 EIQTNSQVLEAYLG 259 E++ N +V+ AYLG Sbjct: 237 EVRANPEVVSAYLG 250 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 253 Length adjustment: 24 Effective length of query: 236 Effective length of database: 229 Effective search space: 54044 Effective search space used: 54044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory