Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_011382485.1 AMB_RS00195 nucleoside-diphosphate sugar epimerase
Query= curated2:Q56623 (328 letters) >NCBI__GCF_000009985.1:WP_011382485.1 Length = 318 Score = 229 bits (584), Expect = 7e-65 Identities = 130/311 (41%), Positives = 179/311 (57%), Gaps = 4/311 (1%) Query: 12 ILLTGSTGFVGTNLVKSLTLKSDYIVKSAVRHAVNKDDGLLFEVGDINASTDFELPLKNT 71 +L+TG+ GFVG L + L ++ + D G + A ++ L+ Sbjct: 3 VLVTGANGFVGQPLCRRLAELGHHVAGAVRGQPYLPDCVERRPAGRLVADGNWSAALEGM 62 Query: 72 TVVVHCAARAHVMDDKEAEPLTLYREVNTAGTVNLAKQAIDSGVKRFIFISSIKVNGEGT 131 VVH AAR HVM D +PL +R N AGT+ LA+QA +G+ +F+SSIK NGE T Sbjct: 63 QAVVHLAARVHVMHDASHDPLAEFRAANGAGTLRLAEQAAQAGIGHLVFLSSIKANGEET 122 Query: 132 LVGCPFKTEDNHAPEDDYGLSKSEAEKQLVALAKDSSMEVVIIRPTIVYGPGVKANFASL 191 PF N AP D YG+SK EAE+ L +A + + V ++RP +VYGPGVK NF +L Sbjct: 123 -THTPFGPL-NAAPVDPYGISKLEAEQGLAEIAARTGLAVTVLRPPLVYGPGVKGNFRAL 180 Query: 192 MRLVSKGIPLPFGSITQNKRSLVSINNLVDLIVTCIDHPKAANQ--VFLVSDGHDVSTAE 249 +RLV++G+PLP G T N+RSL+ + NLVD I +D P Q VF + D STA+ Sbjct: 181 IRLVNRGLPLPLGCCTHNRRSLIGLGNLVDAIRAVLDQPPHPGQCRVFTLCDAEAPSTAD 240 Query: 250 MVRELAIALDKPTWQLPVPIWCYKLFGKLFGKSDIVDRLTGTLQVDISHTKETLGWKPPQ 309 +VR LA AL +P LP+P+ +L L GK + RLT +L+VD S +GW PP+ Sbjct: 241 LVRSLARALGRPARLLPIPVGLMRLGAGLLGKGAAIQRLTASLEVDGSALAAAIGWVPPE 300 Query: 310 TLQEGFKQTAQ 320 TL EG TA+ Sbjct: 301 TLDEGLTATAR 311 Lambda K H 0.318 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 318 Length adjustment: 28 Effective length of query: 300 Effective length of database: 290 Effective search space: 87000 Effective search space used: 87000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory