Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate WP_011382508.1 AMB_RS00310 NAD dependent epimerase/dehydratase
Query= BRENDA::P9WN67 (314 letters) >NCBI__GCF_000009985.1:WP_011382508.1 Length = 341 Score = 200 bits (508), Expect = 5e-56 Identities = 131/307 (42%), Positives = 167/307 (54%), Gaps = 17/307 (5%) Query: 1 MRALVTGAAGFIGSTLVDRLLADGHSVVGLDNFATGRATNLEHLADNSAHVFVEADIVTA 60 + LVTG AGFIGS LVDRLLADGH V +DNFA GR E+LAD A + A Sbjct: 8 LHCLVTGGAGFIGSHLVDRLLADGHRVSVIDNFANGRE---ENLADAKASAPDRLTVHRA 64 Query: 61 DLHAILEQHRP-----EVVFHLAAQIDVRRSVADPQFDAAVNVIGTVRLAEAARQTGVRK 115 D+ A + RP + VFHLAA D+ S+ DP NV GT+ + EAAR GV++ Sbjct: 65 DV-ADADIIRPMFAGVDWVFHLAAMADIVPSIQDPMLYHRANVDGTIAVLEAARAAGVKR 123 Query: 116 IVHTSSGGSIYGTPPEYPTPETAPTDPASPYAAGKVAGEIYLNTFRHLYGLDCSHIAPAN 175 V+T+S S YG P YPTPETA P PYA K GE Y+ + Y L + N Sbjct: 124 FVYTAS-SSCYGIPETYPTPETAAPSPMYPYALTKWVGEQYVMHWAQTYDLAAVSLRLFN 182 Query: 176 VYGPRQDPHGEAGVV-AIFAQALLSGKPTRVFGDGTNTRDYVFVDDVVDAFVRVSADVGG 234 VYGPR G G + +F L+GKP V GDG+ TRD+ FV DV DAFV + Sbjct: 183 VYGPRHRTAGTYGAMFGVFLAQRLAGKPYTVVGDGSQTRDFTFVADVADAFVTAANSKIS 242 Query: 235 GLRFNIGTGKETSDRQLHSAVAAAVGGPDDPEFHPPRLGDLKRSCLDIGLAERVLGWRPQ 294 G FN+G+ S + + +GG D P R G+ + DI +RVLGW+P+ Sbjct: 243 GEIFNVGSDGTYSVNR----IIEILGG--DKLHIPKRPGEPDCTWADIAKIKRVLGWKPK 296 Query: 295 IELADGV 301 + L +GV Sbjct: 297 VSLEEGV 303 Lambda K H 0.320 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 341 Length adjustment: 28 Effective length of query: 286 Effective length of database: 313 Effective search space: 89518 Effective search space used: 89518 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory