Align Probable galactose dehydrogenase GalD; EC 1.1.1.- (characterized)
to candidate WP_011384506.1 AMB_RS10625 3-oxoacyl-[acyl-carrier-protein] reductase
Query= SwissProt::Q92RN6 (256 letters) >NCBI__GCF_000009985.1:WP_011384506.1 Length = 245 Score = 122 bits (307), Expect = 5e-33 Identities = 79/246 (32%), Positives = 127/246 (51%), Gaps = 6/246 (2%) Query: 10 DLRDRGVLVTGGGSGIGAALVEAFARQGARVAFVDIAAESSLALCEKVAAQTGQAPHFIQ 69 DL + LVTG GIG A+ +A +GA V E+ AL AA+ G+ H + Sbjct: 3 DLTGKTALVTGASGGIGGAIAKALHARGATVGLHGTRREALDAL----AAELGERVHVLP 58 Query: 70 ADLRNVEAVRAAADEAVAKLGSVRVLVNNAARDDRQALEAVTEESWDESLSVNLRHLFFM 129 A+L + AV A +A A +GSV +LVNNA + + +E W L VNL F + Sbjct: 59 ANLSDAAAVEQLAKDAEAAMGSVDILVNNAGLTKDGLVLRMKDEDWQTVLDVNLTAAFRL 118 Query: 130 CQAVAPHMQRQGGGSIVNFSSIAFLLNMPEIPAYSTAKAGIIGLTKSLAGKLGPDNIRVN 189 +A ++ G I+N +SI + P Y+ +KAG+IG++K+LA ++ NI VN Sbjct: 119 SRAAVKGQMKRRWGRIINITSIVGVTGNPGQVNYAASKAGMIGMSKALAQEVASRNITVN 178 Query: 190 AILPGMIVTERQRRLWLTEESIARMQERQCLKRMLVADDLVGPCLFLASDSSAAMTAQAM 249 + PG + + L++E ++ RM AD++ ++LAS +A +T Q + Sbjct: 179 CVAPGFVSSAMTD--VLSDEQKTKLNAGIPAGRMGTADEIAAAVVYLASAEAAYVTGQTL 236 Query: 250 IIDGGV 255 ++GG+ Sbjct: 237 HVNGGM 242 Lambda K H 0.321 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 107 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 245 Length adjustment: 24 Effective length of query: 232 Effective length of database: 221 Effective search space: 51272 Effective search space used: 51272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory