Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_011382583.1 AMB_RS00685 phosphoglycerate dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_000009985.1:WP_011382583.1 Length = 318 Score = 138 bits (347), Expect = 2e-37 Identities = 94/274 (34%), Positives = 135/274 (49%), Gaps = 7/274 (2%) Query: 33 DAFVAALKDADGGIGSSVKITPAMLEGATRLKALSTISVGFDQFDVADLTRRGIVLANTP 92 D VA L D + + K+ A+L LK + VG D D+A ++R G L T Sbjct: 44 DDLVAFLLGHDKAVTALEKLDEAVLSRLPDLKVVGKYGVGLDMIDLAAMSRLGKRLGWTG 103 Query: 93 DVLTESTADTVFSLILASARRVVELAEWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRI 152 V S ++ V + +A R + + ++ G W+ L G + +T+GIVG G I Sbjct: 104 GVNRRSVSELVIAFAIALLRHIPQGNALIRDGGWRQ-----LMGRQLSERTVGIVGCGHI 158 Query: 153 GGAVARRAALGFNMKVLYTNRSANPQAEEAYGARRVELAELLATADFVCLQVPLTPETKH 212 G ++R F +VL + P+ A G +++L LLA AD V L +P T++ Sbjct: 159 GKDLSRLLK-AFGCRVLAHDIRDFPEFYAATGVEKMDLEPLLAEADIVTLHLPFDASTRN 217 Query: 213 LIGAAELKSMKKSAILINASRGATVDEKALIEALQNGTIHGAGLDVFETEPLPSDSPLLK 272 ++ A L M+ AILINA+RG VDE AL L G + A DVF TEP P D L++ Sbjct: 218 ILSAERLALMRSDAILINAARGGLVDEAALRVMLATGRLAAAAFDVFATEP-PEDRALIE 276 Query: 273 LANVVALPHIGSATHETRHAMARNAAENLVAALD 306 L N + PH+G + E AM R A L A D Sbjct: 277 LPNFLCTPHVGGSAEEAVLAMGRAAIAGLDEARD 310 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 318 Length adjustment: 28 Effective length of query: 293 Effective length of database: 290 Effective search space: 84970 Effective search space used: 84970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory