Align ABC transporter for Lactose, ATPase component (characterized)
to candidate WP_011383734.1 AMB_RS06730 nitrate ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b20002 (358 letters) >NCBI__GCF_000009985.1:WP_011383734.1 Length = 452 Score = 144 bits (362), Expect = 6e-39 Identities = 88/211 (41%), Positives = 130/211 (61%), Gaps = 11/211 (5%) Query: 4 LQLSDVRKSYGGLE-----VIKGVDLDIKSGEFVVFVGPSGCGKSTLLRMIAGLEEISSG 58 L L VRK++ + V++GVD ++ GE V +G SG GKSTLLR++AGL + + G Sbjct: 11 LDLRGVRKTFLTPDRRERTVLEGVDFKLEEGEIVALLGKSGSGKSTLLRIMAGLIKANGG 70 Query: 59 DLTIDDVRMNDVDPSKRGIAMVFQSYALYPHMTVRENMGFALRFAGVPRAEIEKRVNEAA 118 ++ M P+K GI+MVFQS+AL+P +TV EN+ L AGV +AE E+R NEA Sbjct: 71 EVKYRGHLMTG--PAK-GISMVFQSFALFPWLTVEENVELGLEAAGVAKAEREERANEAI 127 Query: 119 HILELGALLDRKPKQLSGGQRQRVAIGRAIVRHPKIFLFDEPLSNLDAELRVHMRIEIAR 178 ++ LG PK+LSGG RQRV RA+V P + L DEP S LD +R ++ Sbjct: 128 DLIGLGGYESAYPKELSGGMRQRVGFARALVMRPDVLLLDEPFSALDVLTSETLREDLLE 187 Query: 179 L--HKQLATT-IVYVTHDQVEAMTLADKIVV 206 L +++ T I+ V+H+ EA+++AD+++V Sbjct: 188 LWDERKIPTKGILLVSHNIEEAVSMADRVLV 218 Lambda K H 0.321 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 405 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 452 Length adjustment: 31 Effective length of query: 327 Effective length of database: 421 Effective search space: 137667 Effective search space used: 137667 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory