Align 6-P-β-galactosidase (Gan1D) (EC 3.2.1.86) (characterized)
to candidate WP_050750700.1 AMB_RS11280 beta-glucosidase
Query= CAZy::AHL67640.1 (478 letters) >NCBI__GCF_000009985.1:WP_050750700.1 Length = 449 Score = 299 bits (766), Expect = 1e-85 Identities = 174/474 (36%), Positives = 254/474 (53%), Gaps = 37/474 (7%) Query: 3 HRHLKPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYH 62 ++++ P+F+WG +++A+QVEGA EDG+GLS+WD + G + G N DVA DHYH Sbjct: 5 NKNITSLRPDFVWGVSTSAFQVEGATKEDGRGLSIWDTRCRLQGGVWTGANADVACDHYH 64 Query: 63 RYQEDVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTL 122 R+ EDV L+ ++G+ AYRFS++W R+ P G G VN+KGLDFYDRLI+ + GI P V L Sbjct: 65 RWPEDVGLIKDLGVDAYRFSIAWPRLLPKGKGPVNQKGLDFYDRLIDGVLEAGITPWVCL 124 Query: 123 YHWDVPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNEQNIFISFGYRLG 182 YHWD+PQAL D G W +R F YAV +R+GDRVK++ T NE ++F FGY + Sbjct: 125 YHWDLPQAL-DDLGGWTNRDCAGWFADYAVLAAKRYGDRVKHFATFNEFSVFTMFGYAID 183 Query: 183 LHPPGVKDMKRMYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLA 242 PGV D +A H NLA+ + R +V D IG + P EN A Sbjct: 184 WAAPGVTDRAAHMKAIHHVNLAHGMGVDVLRDHVKDVSIGAIHNRQIVRPEGGLAENQAA 243 Query: 243 FENAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKP-DFMGVNYY 301 + + N + D G YP+ + ++ +EP V GD L + +P D+MG+N+Y Sbjct: 244 ADLLDAHWNGVFCDPQHLGHYPE-----IMARDVEPYVQAGD--LARICRPTDWMGLNHY 296 Query: 302 QTTTVEHNPPDGVGEGVMNTTGKKGTSTSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRI 361 + +P G G G P ++ +P V W I P + Sbjct: 297 GPIYAKADPATTWGYG-------------WGAPP--ESANHPEV-----GWPIFPEVFKD 336 Query: 362 GLRRIANRYQLPILITENGLG---EFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVD 418 L + RY LP+ +TENG G DT + +V+D +R+ Y R + Q + A+ +G D Sbjct: 337 ELLTLTRRYGLPVYVTENGCGGGAGSDTPDENGVVDDTHRLAYFREYQQAMLDAVAEGAD 396 Query: 419 VLGYCAWSFTDLLSWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIE 472 V GY W+ D W +GY R+G +V+ D + +R K S WY+ +I+ Sbjct: 397 VRGYFVWALLDNFEWGSGYGPRFGLYHVDFDSQ-----KRTLKNSGKWYRDMIK 445 Lambda K H 0.320 0.139 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 852 Number of extensions: 48 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 478 Length of database: 449 Length adjustment: 33 Effective length of query: 445 Effective length of database: 416 Effective search space: 185120 Effective search space used: 185120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory