Align 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (characterized)
to candidate WP_011384714.1 AMB_RS11710 pyruvate dehydrogenase complex E1 component subunit beta
Query= metacyc::MONOMER-11684 (327 letters) >NCBI__GCF_000009985.1:WP_011384714.1 Length = 452 Score = 246 bits (627), Expect = 1e-69 Identities = 134/318 (42%), Positives = 192/318 (60%), Gaps = 3/318 (0%) Query: 8 DAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLYEQFGEERVMDTPLAESAIAGVG 67 +A+ AM EEM D VF++GE+V + G +K + GL ++FG ERV+DTP+ E AG+ Sbjct: 133 EALRDAMAEEMRADPNVFLMGEEVAQYQGAYKVSQGLLDEFGAERVIDTPITEMGFAGLA 192 Query: 68 IGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYGGGVHGAL 127 GA G++PI E +F M A++ +I+ AAK Y S C IV R P G Sbjct: 193 CGAGYAGLKPIVEFMTMNFSMQAIDHVINSAAKTLYMSGGQQPCSIVFRGPNGAASRVGA 252 Query: 128 YHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYRLIKGEVPAD 187 HSQ + +A+ PGLK++ P + DAKGLLKAA+RD +PV+F E++ Y +VP D Sbjct: 253 QHSQDYASWYAHCPGLKVLAPWSAADAKGLLKAAIRDPNPVVFLENELLYGQ-SFDVPDD 311 Query: 188 -DYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLRTVYPLDKEA 246 D+VLPIGKA ++R G +T+ Y V AL AAE L+ +GI A V++LR++ PLD Sbjct: 312 PDFVLPIGKAKIERAGAHVTITAYSRMVQVALDAAEILKAEGIEAEVINLRSIRPLDVAT 371 Query: 247 IIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFDLDAPIKRLAGPDIPAMPYAPTM 306 I+ + KT +++ V E I SE+AA++ E LDAP+ R+AG D+P MPYA + Sbjct: 372 IVASVQKTNRIVSVEEGWPVAGIGSEIAALMMEQAFDWLDAPVVRVAGADVP-MPYAANL 430 Query: 307 EKYFMVNPDKVEAAMREL 324 EK + + V AA R + Sbjct: 431 EKLALPQIEHVVAAARSV 448 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 452 Length adjustment: 30 Effective length of query: 297 Effective length of database: 422 Effective search space: 125334 Effective search space used: 125334 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory