GapMind for catabolism of small carbon sources

 

Aligments for a candidate for liuB in Magnetospirillum magneticum AMB-1

Align methylcrotonoyl-CoA carboxylase (subunit 2/2) (EC 6.4.1.4) (characterized)
to candidate WP_011383117.1 AMB_RS03465 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha

Query= BRENDA::Q9I299
         (655 letters)



>lcl|NCBI__GCF_000009985.1:WP_011383117.1 AMB_RS03465
           acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit
           alpha
          Length = 665

 Score =  669 bits (1727), Expect = 0.0
 Identities = 362/660 (54%), Positives = 451/660 (68%), Gaps = 19/660 (2%)

Query: 10  RLLVANRGEIACRVMRSARALGIGSVAVHSDIDRHARHVAEADIAVDLGGAKPADSYLRG 69
           ++L+ANRGEIACRVMR+A+ LGI +VAV+S+ D +A HVA AD AV +G A  A+SYL+G
Sbjct: 4   KILIANRGEIACRVMRTAKRLGIRTVAVYSEADANAMHVAMADEAVLIGPAAAAESYLKG 63

Query: 70  DRIIAAALASGAQAIHPGYGFLSENADFARACEEAGLLFLGPPAAAIDAMGSKSAAKALM 129
           D I+ AA  +GAQAIHPGYGFLSENA FA AC +AG++F+GPP  AI AMGSK+ +K LM
Sbjct: 64  DVILEAAKRTGAQAIHPGYGFLSENAGFAEACAKAGVVFIGPPVGAIHAMGSKAESKRLM 123

Query: 130 EEAGVPLVPGYHGEAQDLETFRREAGRIGYPVLLKAAAGGGGKGMKVVEREAELAEALSS 189
           E AGVPLVPGYHG+ Q LE   REA  IGYPVL+KA+AGGGGKGM+VV   + LAEA++S
Sbjct: 124 EAAGVPLVPGYHGKGQTLEELTREAAIIGYPVLVKASAGGGGKGMRVVSEASGLAEAVAS 183

Query: 190 AQREAKAAFGDARMLVEKYLLKPRHVEIQVFADRHGHCLYLNERDCSIQRRHQKVVEEAP 249
           A+REAKAAFGD  +L+E YL +PRHVEIQVF D HG+ +YL ERDCSIQRRHQKV+EEAP
Sbjct: 184 AKREAKAAFGDDSLLLETYLGRPRHVEIQVFCDTHGNGVYLFERDCSIQRRHQKVIEEAP 243

Query: 250 APGLGAELRRAMGEAAVRAAQAIGYVGAGTVEFLLDERGQFFFMEMNTRLQVEHPVTEAI 309
           AP L  E RRAMGEAAV AAQA+ YVGAGTVEFL  + G+FFF+EMNTRLQVEHPVTE I
Sbjct: 244 APALADETRRAMGEAAVAAAQAVDYVGAGTVEFLYQD-GRFFFIEMNTRLQVEHPVTEMI 302

Query: 310 TGLDLVAWQIRVARGEALPLTQEQVPLNGHAIEVRLYAEDPEGDFLPASGRLMLYREAAA 369
           TGLDLV WQ+ VA G  LPL QEQ+   GHA E RLYAEDP  DFLPA G+L+     + 
Sbjct: 303 TGLDLVEWQLLVASGGKLPLAQEQLSRKGHAFEARLYAEDPSRDFLPAIGKLVHLAPPSE 362

Query: 370 GPGRRVDSGVREGDEVSPFYDPMLAKLIAWGETREEARQRLLAMLAETSVGGLRTNLAFL 429
               RVD+GVR+GD+V+PFYDPM+AKLI W E R+ A +RL   LA+  V G+ TN++FL
Sbjct: 363 NRHVRVDTGVRQGDQVTPFYDPMIAKLIVWDEDRDSALRRLRRALADYQVAGVTTNVSFL 422

Query: 430 RRILGHPAFAAAELDTGFIARHQDDLLPAPQALPE---HFWQAAAEAWLQSEPGH--RRD 484
             I  HPAFAA E+DTGFI R++ DL P    +P     F   A   W + +      R 
Sbjct: 423 GAIAAHPAFAALEIDTGFIERYRADLQPPAAPVPAMGLAFASLALLLWREEDSARTAARS 482

Query: 485 DDPHSPWSRNDGWRSALARESDL-MLRCRDERRC------------VRLRHASPSQYRLD 531
            DPHSPW + +GWR       D   +   DERR             +  +  S  +  L 
Sbjct: 483 GDPHSPWHQTNGWRLNDDNHHDFRFMDGADERRVTVHFVADGWSLDLPDQTLSARRATLS 542

Query: 532 GDDLVSRVDGVTRRSAALRRGRQLFLEWEGELLAIEAVDPIAEAEAAHAHQGGLSAPMNG 591
           G  L + + G  R ++ +R G  + +  +G    I+  DP A A       G L+APM G
Sbjct: 543 GTTLSAEIGGERRTASVVRSGFDITVLHDGHAWKIKLDDPSATAAEREGGDGRLAAPMPG 602

Query: 592 SIVRVLVEPGQTVEAGATLVVLEAMKMEHSIRAPHAGVVKALYCSEGELVEEGTPLVELD 651
           ++V+VLV+PG  V AG  L+V+EAMKMEH+I+AP  G V A++   G+ V EG  L+  +
Sbjct: 603 TVVQVLVQPGDAVTAGQPLIVVEAMKMEHAIKAPAEGKVAAIHFKVGDTVAEGVELLAFE 662


Lambda     K      H
   0.319    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1082
Number of extensions: 44
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 655
Length of database: 665
Length adjustment: 38
Effective length of query: 617
Effective length of database: 627
Effective search space:   386859
Effective search space used:   386859
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory