Align ABC transporter for L-Lysine, ATPase component (characterized)
to candidate WP_011384493.1 AMB_RS10565 ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_05515 (254 letters) >NCBI__GCF_000009985.1:WP_011384493.1 Length = 257 Score = 150 bits (379), Expect = 2e-41 Identities = 89/251 (35%), Positives = 147/251 (58%), Gaps = 13/251 (5%) Query: 3 KLTIEGLHKSYGEHEVLKGVSLKAKTGDVISLIGASGSGKSTFLRCINFLEQPNDGAMTL 62 K+ + G+HK++G VL G+ L G+ + +IG SG+GKS L+CI L +P G++ + Sbjct: 6 KIELTGVHKAFGPKVVLDGIDLSVARGESVVVIGGSGTGKSVMLKCILGLLRPESGSIRI 65 Query: 63 DGQPVQMIKDRHGMHVADADELQRIRTRLAMVFQHFNLWSHMTVLENITMAPRRVLGVSK 122 DG+ V GM D D RI + M+FQ L+ + V EN+ + + + Sbjct: 66 DGEDVV------GMGPKDRD---RIMKKFGMLFQGGALFDSLKVWENVAFGLIQGQKMER 116 Query: 123 QEADDRARRYLDKVGLPARVAEQYPAFLSGGQQQRVAIARALAMEPEVMLFDEPTSALDP 182 +A D A L +VGL A E P+ LSGG Q+RV++ARA+A PE++ FDEPT+ LDP Sbjct: 117 AKARDIAIEKLAQVGLAASTGELSPSELSGGMQKRVSLARAIATNPEIIFFDEPTTGLDP 176 Query: 183 ELVGEVLK--VIQGLAEEGRTMIMVTHEMSFARKVSNQVLFLHQGLVEEEGAPEDVLGNP 240 ++ +V+ +++ E G T + +TH+M+ ARK+S+++ L++G + G +D+ + Sbjct: 177 -IMADVINDLIVKCCKEVGATALSITHDMASARKISDRIAMLYKGRLIWVGPAKDI-DHS 234 Query: 241 KSERLKQFLSG 251 +E + QF+ G Sbjct: 235 GNEYVDQFIHG 245 Lambda K H 0.319 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 257 Length adjustment: 24 Effective length of query: 230 Effective length of database: 233 Effective search space: 53590 Effective search space used: 53590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory