Align Putative oxidoreductase (characterized, see rationale)
to candidate WP_011385361.1 AMB_RS15030 FAD-binding protein
Query= uniprot:Q92L08 (473 letters) >NCBI__GCF_000009985.1:WP_011385361.1 Length = 457 Score = 117 bits (293), Expect = 8e-31 Identities = 122/447 (27%), Positives = 191/447 (42%), Gaps = 56/447 (12%) Query: 42 AVLRPVTTEEVSAAVGYCVRSGIALIPQSGNTGLVSGSTPDESGSEVVVS-LDRLTRQFA 100 AV+ +TEEV+ V C G +I T L + G + VS ++R+ A Sbjct: 43 AVVFAQSTEEVAETVKACAAHGTPVIAFGTGTSLEGHVAALKGGVCIDVSGMNRVLEVRA 102 Query: 101 LDLDNRSVRVDAGFRLSELNRRLEEHGLFFPIDLGADPRIGGMIATNTGGSRFLKYGDVR 160 DLD V V G +LN L + GLFFPID GAD +GGM AT G+ ++YG +R Sbjct: 103 EDLD---VTVQPGVTRKQLNEYLRDTGLFFPIDPGADASLGGMAATRASGTNAVRYGTMR 159 Query: 161 RNTLGLKVVLADEAGTVLDLGSDLRKNNTGVDWKQIFIGTSGAFGIVTECVLNLERLPKQ 220 N L L+VVL D G V+ RK++ G D ++F+G+ G GI+TE L L+ +P+ Sbjct: 160 ENVLSLQVVLPD--GRVIRTAGRARKSSAGYDLTRLFVGSEGTLGIITELTLRLQGIPEA 217 Query: 221 TATAFL-VPASGAHVLPLLKAMEERLGAYLSAFEGMSRNAIAAA-------FAHVPALKN 272 + A P+ A V ++ ++ G ++ E + + I A P L Sbjct: 218 ISAAVCPFPSIEAAVNTVILTIQS--GVPVARIEFLDKVMIGAVNRYSKTDHREAPTLFF 275 Query: 273 PFQGGKVPDYVILAEISRTSSPREGEQPLDAVLESVLAEIWEMEEVLLADALVGPPHEIW 332 F G +S +E + ++A+ AE ++ ++W Sbjct: 276 EFHGS-------------PASVQEQAEKVEAIATEFGAEGFQWA------TGAEERTKLW 316 Query: 333 ALRH-------ALSEGVKHLGKLIAFDLSFRRGDIMAFCDHMKTEMPEKFPGVTVCDFGH 385 A RH L G + +S +A C ++TE K + GH Sbjct: 317 AARHNAYYAGVGLRPGCRAWTTDACVPIS-----RLAEC-LLETEEDLKTTPLISAIVGH 370 Query: 386 IGDGGVHFNLVVAKDSPLLADATFEQRLREWVFAVAVEQYHGSFSAEHALGRRNQAFYDL 445 +GDG H L+V P +A +R+ + A+ G+ + EH +G AF + Sbjct: 371 VGDGNFHVMLLVDPGKP--EEAAEAERINHRIVRRALAM-DGTCTGEHGVGHGKMAFLEE 427 Query: 446 YTPEKLKNMAAGLKT-----LTSPGKL 467 E L M A + + +PGK+ Sbjct: 428 EYGEALDVMRAVKRAIDPAGIMNPGKI 454 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 492 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 473 Length of database: 457 Length adjustment: 33 Effective length of query: 440 Effective length of database: 424 Effective search space: 186560 Effective search space used: 186560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory