Align ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized)
to candidate WP_011384263.1 AMB_RS09395 ABC transporter ATP-binding protein
Query= BRENDA::P68187 (371 letters) >NCBI__GCF_000009985.1:WP_011384263.1 Length = 273 Score = 145 bits (365), Expect = 2e-39 Identities = 82/211 (38%), Positives = 121/211 (57%), Gaps = 5/211 (2%) Query: 4 VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIG 63 + +Q ++ ++G +D +L+I GEFV +GPSGCGKST L +AG G + + Sbjct: 17 IGIQRLSVSFGAHAAVEDFSLEIEPGEFVCLLGPSGCGKSTALNAVAGFLRPARGRVAVD 76 Query: 64 EKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQL 123 + P GMVFQ ++L+P +V EN++FG ++ G + + +++ L Sbjct: 77 GVEVTGPGPER---GMVFQQHSLFPWKTVLENVAFGPRMQGKTRAEARDLAREYLDLVGL 133 Query: 124 AHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRL 183 R P ALSGG QRV I R LV PSV L+DEP LDA R M+ + RL ++ Sbjct: 134 GGSAQRYPAALSGGMAQRVGIARALVNHPSVLLMDEPFGALDAQTRSIMQESLLRLWGQI 193 Query: 184 GRTMIYVTHDQVEAMTLADKIVVLDA--GRV 212 G T+++VTHD EA+ LAD++VV+ A GRV Sbjct: 194 GNTVLFVTHDIDEALFLADRVVVMSAAPGRV 224 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 273 Length adjustment: 27 Effective length of query: 344 Effective length of database: 246 Effective search space: 84624 Effective search space used: 84624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory