Align Probable NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; Short chain dehydrogenase/reductase; YlSDR; EC 1.1.1.138 (characterized)
to candidate WP_011383322.1 AMB_RS04485 NAD(P)-dependent oxidoreductase
Query= SwissProt::Q6CEE9 (278 letters) >NCBI__GCF_000009985.1:WP_011383322.1 Length = 250 Score = 87.8 bits (216), Expect = 2e-22 Identities = 80/261 (30%), Positives = 123/261 (47%), Gaps = 32/261 (12%) Query: 30 SLKGKVASITGSSSGIGFAVAEAFAQAGADVAIWYNSKPSDEKAEYLSKTYGVRSKAYKC 89 SL GKVA +TG+SSGIG A+A+ F GA VA++ + + L+K A Sbjct: 4 SLSGKVAVVTGASSGIGHAIAQRFLAEGAKVAVFARNAAA---LADLAKGREDSVLAVTG 60 Query: 90 AVTNAKQVETTIQTIEKDFGKIDIFIANAGIPWTAGPMIDVPNNEEWDKVVDLDLNGAYY 149 VT A +E + K FG +D+ I NAGI VP + +D + Sbjct: 61 DVTCAADLERLVAETVKRFGGVDMVIPNAGIAKV------VPFEQSDAAAID-----HQF 109 Query: 150 CAKYAGQIFKKQGY-------GSFIFTASMSGHIVNIPQMQACYNAAKCAVLHLSRSLAV 202 + G + +G+ GS +F + V P + A Y+A+K A+ S++LA Sbjct: 110 AVNFTGAVQTVRGFLPHIRQGGSVLFVTTFLTQ-VGFPGL-AIYSASKAALKSFSQTLAA 167 Query: 203 EWAGFA-RCNTVSPGYMATEI-------SDFIPRDTKEKWWQLIPMGREGDPSELAGAYI 254 E A R N+V+PG + T I +D + + +L+P G G+P ++A Sbjct: 168 ELAPKGIRVNSVAPGPIGTPIWGSIGLPADVLQAVATQVTARLMP-GAFGEPGDIAATAA 226 Query: 255 YLASDASTYTTGADILVDGGY 275 +L SD + G +I+VDGGY Sbjct: 227 FLCSDQAKNIWGQEIVVDGGY 247 Lambda K H 0.317 0.132 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 250 Length adjustment: 25 Effective length of query: 253 Effective length of database: 225 Effective search space: 56925 Effective search space used: 56925 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory