Align MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized)
to candidate WP_011385763.1 AMB_RS17210 molybdenum import ATP-binding protein ModC
Query= TCDB::O30494 (367 letters) >NCBI__GCF_000009985.1:WP_011385763.1 Length = 363 Score = 139 bits (349), Expect = 2e-37 Identities = 87/265 (32%), Positives = 143/265 (53%), Gaps = 17/265 (6%) Query: 36 GPSGCGKSTLLRLIAGLEEVSEGTIELDGRDI------TEVTPAKRDLAMVFQTYALYPH 89 G SG GK++++ ++AGL EG+I +DGR + ++ P R L VFQ + L+PH Sbjct: 30 GRSGSGKTSVINMVAGLSRPDEGSISVDGRVLFDSRSGIDLPPEARRLGYVFQEHRLFPH 89 Query: 90 MSVRKNMSFALDLAGVDKQLVESKVNEAARILELGPLLERKPKQLSGGQRQRVAIGRAIV 149 +SVR N+ F L ++ +++ +L + LL+R+P +LSGG++QRVAIGRA++ Sbjct: 90 LSVRGNLEFGQKLLPSAERT--QSLDKVVELLGIESLLDRRPAKLSGGEKQRVAIGRALL 147 Query: 150 RNPKIFLFDEPLSNLDAALRVQMRLELARLHKELQATMIYVTHDQVEAMTLADKVVVLNS 209 +P+I L DEPL+ LD A + ++ +A+L + ++YV+H E + LAD + +++ Sbjct: 148 ASPRILLMDEPLAALDPARKAEVLPFIAQLARRFSVPILYVSHSMDEVLRLADTLALMDG 207 Query: 210 GRIEQVGSPLELYHQPANLFVAGFLGTPKMGFLKGKVTRVDGQG---CEVQLDAGTLISL 266 G++ G L P + G + G + G V G + D GTLI Sbjct: 208 GKVAASGPLESLMGDPG---LRPLTGRYEAGAVIGAVVSSHDSGFGISRLAFDGGTLI-- 262 Query: 267 PLSGASLSVGSAVTLGIRPEHLEIA 291 + + L VG+ V L I + IA Sbjct: 263 -VGRSELPVGAKVRLRIHARDVAIA 286 Lambda K H 0.319 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 315 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 363 Length adjustment: 30 Effective length of query: 337 Effective length of database: 333 Effective search space: 112221 Effective search space used: 112221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory