Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_011384493.1 AMB_RS10565 ABC transporter ATP-binding protein
Query= TCDB::Q9X272 (328 letters) >NCBI__GCF_000009985.1:WP_011384493.1 Length = 257 Score = 121 bits (304), Expect = 2e-32 Identities = 79/237 (33%), Positives = 130/237 (54%), Gaps = 15/237 (6%) Query: 12 PLLQTVDLKKYFPQGKRILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLLRPDG 71 P ++ + K F G +++ +DGI + + GE++ ++G SG GKS + + IL LLRP+ Sbjct: 5 PKIELTGVHKAF--GPKVV--LDGIDLSVARGESVVVIGGSGTGKSVMLKCILGLLRPES 60 Query: 72 GKIFFEGKDITNLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKIGTKKE 131 G I +G+D+ + K+ KK ++FQ G+L + V + LI G K E Sbjct: 61 GSIRIDGEDVVGMGPKDRDRIMKKFGMLFQG--GALFDSLKVWENVAFGLIQ---GQKME 115 Query: 132 RRKRVE---ELLDMVGIGREFINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSALD 188 R K + E L VG+ P E SGG Q+R+ +ARA+A NP+ I DEP + LD Sbjct: 116 RAKARDIAIEKLAQVGLAASTGELSPSELSGGMQKRVSLARAIATNPEIIFFDEPTTGLD 175 Query: 189 VSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYG---DVD 242 + I DL+ + +++G + L I H++A IS ++A++Y G+++ G D+D Sbjct: 176 PIMADVINDLIVKCCKEVGATALSITHDMASARKISDRIAMLYKGRLIWVGPAKDID 232 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 257 Length adjustment: 26 Effective length of query: 302 Effective length of database: 231 Effective search space: 69762 Effective search space used: 69762 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory