Align Inositol 2-dehydrogenase 3; EC 1.1.1.18; Myo-inositol 2-dehydrogenase 3; MI 2-dehydrogenase 3 (uncharacterized)
to candidate WP_011382573.1 AMB_RS00635 gfo/Idh/MocA family oxidoreductase
Query= curated2:A4FIQ1 (338 letters) >NCBI__GCF_000009985.1:WP_011382573.1 Length = 337 Score = 89.0 bits (219), Expect = 2e-22 Identities = 59/182 (32%), Positives = 97/182 (53%), Gaps = 5/182 (2%) Query: 3 VRVGVIGTGMIGQDHIRRLTRVVTGAEIVAVTDIDADR-AASVAGGVGARTMPSGADVIG 61 ++VGVIG G G + +R ++VAV D+D+ R AA+ G RT + AD+ Sbjct: 2 IKVGVIGFGYWGPNLVRNFA-TSDRCKMVAVADLDSKRLAAAERSYPGIRTTTNPADLFA 60 Query: 62 SADVDAVLVTSWGPTHAEHVLAAIEAGKAVFCEKPLATEVEDCLRIVEAESARGKRLVQV 121 +AD+DAV +++ H + LAA++AGK V EKP+A DC R+++ E+A+ K + V Sbjct: 61 AADIDAVAISTPVQYHFDLALAALQAGKHVLVEKPMAASAADCRRLID-EAAKRKLTLMV 119 Query: 122 GFMRRYDAGYREMKELVDAGGIGTPLMAHCVHRNPTVPETYHSAMAAQDTAVHEIDTLRW 181 Y ++M++LV G +G V N + + H D AVH++ + + Sbjct: 120 DHTFIYTPAVQKMRDLVQTGELGEIYYYDSVRVNLGLFQ--HDVNVLWDLAVHDLSIIEY 177 Query: 182 LL 183 +L Sbjct: 178 VL 179 Lambda K H 0.319 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 337 Length adjustment: 28 Effective length of query: 310 Effective length of database: 309 Effective search space: 95790 Effective search space used: 95790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory