Align Inositol 2-dehydrogenase; EC 1.1.1.18; Myo-inositol 2-dehydrogenase; MI 2-dehydrogenase (uncharacterized)
to candidate WP_011382585.1 AMB_RS00695 gfo/Idh/MocA family oxidoreductase
Query= curated2:C5BYN4 (360 letters) >NCBI__GCF_000009985.1:WP_011382585.1 Length = 314 Score = 65.9 bits (159), Expect = 1e-15 Identities = 47/136 (34%), Positives = 72/136 (52%), Gaps = 4/136 (2%) Query: 3 VRIGVVGPGGMGRAHIDRITGELAGGAVVAVHDIDEVNARRVAEPIGAKVFGSATELVAS 62 VR+ ++G G GR +I I G L G A+V + + + V P G V +A+ Sbjct: 10 VRLALIGAGRWGRNYIRTIAG-LPGAALVRLASSNPES--HVLAPPGCVVDAHWRTSIAA 66 Query: 63 DAVDAVLVASDGTAHLEPVLAAVAAGKPVLCEKPLAPTAAECEQVMAAEVAAGRRLVTIG 122 V+AV+V++ +H E LAA+AAGK VL EKPL E + + A AG +V + Sbjct: 67 PEVEAVIVSTPPASHAEITLAAIAAGKAVLVEKPLTLDLGEADAIARAAREAG-AMVWVE 125 Query: 123 FMRRFDASYLAMKAVL 138 + F+ ++ A+KA L Sbjct: 126 HTQLFNPAWTALKAAL 141 Lambda K H 0.319 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 314 Length adjustment: 28 Effective length of query: 332 Effective length of database: 286 Effective search space: 94952 Effective search space used: 94952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory