Align Benzoyl-CoA reductase subunit D; 3-hydroxybenzoyl-CoA reductase subunit delta; EC 1.3.7.8; EC 1.3.99.n1 (characterized)
to candidate WP_011384538.1 AMB_RS10810 benzoyl-CoA reductase subunit A
Query= SwissProt::O87877 (282 letters) >NCBI__GCF_000009985.1:WP_011384538.1 Length = 430 Score = 100 bits (248), Expect = 7e-26 Identities = 64/198 (32%), Positives = 101/198 (51%), Gaps = 2/198 (1%) Query: 65 YVATTGEGE-SLAFHTGHFYS-MTTHARGAVYLNPEARAVLDIGALHGRAIRNDERGKVE 122 YV TG G L F H S + H GA + P+ R VLDIG + I+ D G VE Sbjct: 224 YVVGTGYGRVRLPFPKEHIRSEILCHGLGAHMMYPDTRTVLDIGGQDTKGIQVDPVGIVE 283 Query: 123 TYKMTSQCASGSGQFLENIARYLGIAQDEIGSLSTQADNPEVVSSICAVLAETDVINMVS 182 ++M +CA+G G++L IA + + E+G L+ +++ ++S C V A ++ + ++ Sbjct: 284 NFQMNDRCAAGCGRYLGYIADEMNMGLHELGPLAMKSNKQVRINSTCTVFAGAELRDRLA 343 Query: 183 RGISAPNILKGIHISMAGRLAKLLKSVGARDGVVLCTGGLALDEGLLKTLNESIQEQKMA 242 G +IL G+H ++ R +L G TGG+A +E ++ L + I+E Sbjct: 344 LGEKREDILAGLHRAIILRAMSILSRAGGVKDQFTFTGGVAKNEAAVRELRKLIKENYGD 403 Query: 243 VVAYNHPDSPYAGAIGAA 260 V PDS Y GA+G A Sbjct: 404 VTINIDPDSIYTGALGGA 421 Lambda K H 0.316 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 430 Length adjustment: 29 Effective length of query: 253 Effective length of database: 401 Effective search space: 101453 Effective search space used: 101453 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory