Align cyclohexa-1,5-dienecarbonyl-CoA hydratase (EC 4.2.1.100) (characterized)
to candidate WP_011384541.1 AMB_RS10825 cyclohexa-1,5-dienecarbonyl-CoA hydratase
Query= BRENDA::O87873 (258 letters) >NCBI__GCF_000009985.1:WP_011384541.1 Length = 259 Score = 337 bits (865), Expect = 1e-97 Identities = 174/254 (68%), Positives = 204/254 (80%) Query: 5 SSPLKVWLERDGSLLRLRLARPKANIVDAAMIAAMRQALGEHLQAPALRAVLLDAEGPHF 64 S+ LKVW +R+G LLRLRL+RPKANIVDA MIAA+ ALG+ + ALRAVL+D EGPHF Sbjct: 6 SNCLKVWKDREGKLLRLRLSRPKANIVDAEMIAALSAALGDAHEDSALRAVLIDHEGPHF 65 Query: 65 SFGASVDEHMPDQCAQMLKSLHGLVREMLDSPVPILVALRGQCLGGGLEVAAAGNLLFAA 124 SFGASV EHMPDQCA ML SLH LV M+D P+PILVA+RGQCLGGGLEVA AG+++F + Sbjct: 66 SFGASVAEHMPDQCAAMLASLHKLVIAMVDFPLPILVAVRGQCLGGGLEVALAGHMMFVS 125 Query: 125 PDAKFGQPEIRLGVFAPAASCLLPPRVGQACAEDLLWSGRSIDGAEGHRIGLIDVLAEDP 184 PDAK GQPEI LGVFAPAASCLLP R+ + AEDLL+SGRSIDGAE R+G+ + + +DP Sbjct: 126 PDAKLGQPEIVLGVFAPAASCLLPERMPRVAAEDLLYSGRSIDGAEAARLGIANAVVDDP 185 Query: 185 EAAALRWFDEHIARLSASSLRFAVRAARCDSVPRIKQKLDTVEALYLEELMASHDAVEGL 244 E AAL WFD A+ SA+SLRFAV+AAR R+K K+ VEALYL LMA+HDAVEGL Sbjct: 186 ENAALAWFDNGPAKHSAASLRFAVKAARLGMNERVKAKIAEVEALYLNGLMATHDAVEGL 245 Query: 245 KAFLEKRSANWENR 258 AFLEKR A WE+R Sbjct: 246 NAFLEKRPALWEDR 259 Lambda K H 0.321 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 259 Length adjustment: 24 Effective length of query: 234 Effective length of database: 235 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate WP_011384541.1 AMB_RS10825 (cyclohexa-1,5-dienecarbonyl-CoA hydratase)
to HMM TIGR03189 (cyclohexa-1,5-dienecarbonyl-CoA hydratase (EC 4.2.1.100))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03189.hmm # target sequence database: /tmp/gapView.6819.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03189 [M=251] Accession: TIGR03189 Description: dienoyl_CoA_hyt: cyclohexa-1,5-dienecarbonyl-CoA hydratase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-157 507.6 5.9 2.9e-157 507.5 5.9 1.0 1 lcl|NCBI__GCF_000009985.1:WP_011384541.1 AMB_RS10825 cyclohexa-1,5-dienec Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009985.1:WP_011384541.1 AMB_RS10825 cyclohexa-1,5-dienecarbonyl-CoA hydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 507.5 5.9 2.9e-157 2.9e-157 1 251 [] 9 259 .] 9 259 .] 1.00 Alignments for each domain: == domain 1 score: 507.5 bits; conditional E-value: 2.9e-157 TIGR03189 1 lkvwlerdgkllrlrlarpkanivdaamiaalraalgealeaaalravlldaegphfsfgasveehmpd 69 lkvw++r+gkllrlrl+rpkanivda+miaal+aalg+a+e++alravl+d+egphfsfgasv+ehmpd lcl|NCBI__GCF_000009985.1:WP_011384541.1 9 LKVWKDREGKLLRLRLSRPKANIVDAEMIAALSAALGDAHEDSALRAVLIDHEGPHFSFGASVAEHMPD 77 8******************************************************************** PP TIGR03189 70 qcaamlkslhklviemldspvpilvavrgqclggglevaaagnllfaapdaklgqpeiklgvfapaasc 138 qcaaml+slhklvi+m+d+p+pilvavrgqclgggleva+ag+++f++pdaklgqpei+lgvfapaasc lcl|NCBI__GCF_000009985.1:WP_011384541.1 78 QCAAMLASLHKLVIAMVDFPLPILVAVRGQCLGGGLEVALAGHMMFVSPDAKLGQPEIVLGVFAPAASC 146 ********************************************************************* PP TIGR03189 139 llpervgkvaaedllysgrsidgaegariglvdavaedpeaaalayfdehlaklsasslrfavraarlg 207 llper+++vaaedllysgrsidgae+ar+g+++av++dpe+aala+fd+++ak+sa+slrfav+aarlg lcl|NCBI__GCF_000009985.1:WP_011384541.1 147 LLPERMPRVAAEDLLYSGRSIDGAEAARLGIANAVVDDPENAALAWFDNGPAKHSAASLRFAVKAARLG 215 ********************************************************************* PP TIGR03189 208 vvervkakiaevealyleelmathdaveglnaflekrpaawedr 251 ++ervkakiaevealyl++lmathdaveglnaflekrpa+wedr lcl|NCBI__GCF_000009985.1:WP_011384541.1 216 MNERVKAKIAEVEALYLNGLMATHDAVEGLNAFLEKRPALWEDR 259 *******************************************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (251 nodes) Target sequences: 1 (259 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.25 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory