Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_011382625.1 AMB_RS00905 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase
Query= BRENDA::P77467 (262 letters) >NCBI__GCF_000009985.1:WP_011382625.1 Length = 261 Score = 293 bits (750), Expect = 2e-84 Identities = 152/262 (58%), Positives = 183/262 (69%), Gaps = 1/262 (0%) Query: 1 MMEFILSHVEKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGF 60 M E IL V T+TLNRP R+N+FN EMH L + D T RCL++TGAG+GF Sbjct: 1 MSETILVARTGDVTTITLNRPGRINAFNVEMHGALRSAVAHAAEDGT-RCLVITGAGKGF 59 Query: 61 CAGQDLNDRNVDPTGPAPDLGMSVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLALG 120 CAGQDL+DR P P PDLG S++ YNPL+R L LP PVI AVNG AAGAGA LAL Sbjct: 60 CAGQDLSDRVSKPGDPPPDLGASLDARYNPLIRSLKALPMPVIAAVNGTAAGAGANLALA 119 Query: 121 GDIVIAARSAKFVMAFSKLGLIPDCGGTWLLPRVAGRARAMGLALLGNQLSAEQAHEWGM 180 DIV+AARSA FV +F K+GLIPD GGTW LPR+ G ARA L +LG +++AEQA +WGM Sbjct: 120 CDIVVAARSAAFVQSFCKVGLIPDSGGTWTLPRLVGTARATALMMLGEKVTAEQAMQWGM 179 Query: 181 IWQVVDDETLADTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQLDLERDYQRLAGR 240 IW+ VDDE L T +A LA QPT GL L+K+A+ + NTLD QLDLERD Q AG Sbjct: 180 IWRCVDDEQLLPTVLAMAAQLAAQPTRGLALMKKALARSGANTLDAQLDLERDLQTEAGC 239 Query: 241 SADYREGVSAFLAKRSPQFTGK 262 + DY+EGV AF+ KR P+F G+ Sbjct: 240 TQDYQEGVRAFMEKRPPRFEGR 261 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 261 Length adjustment: 25 Effective length of query: 237 Effective length of database: 236 Effective search space: 55932 Effective search space used: 55932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory