Align phenylacetate-CoA ligase (EC 6.2.1.30) (characterized)
to candidate WP_011383657.1 AMB_RS06320 phenylacetate--CoA ligase
Query= BRENDA::B4EL89 (440 letters) >NCBI__GCF_000009985.1:WP_011383657.1 Length = 432 Score = 477 bits (1227), Expect = e-139 Identities = 243/430 (56%), Positives = 316/430 (73%), Gaps = 9/430 (2%) Query: 14 IETASRDELQALQLERLKWSLRHAYDNVPHYRRTFDAAGVHPDDLKSLADLAKFPFSTKN 73 +E R L+ALQL+RL+ L HAY +VPH R FDAAG+ PDDL+ L DLA+FPF+ K Sbjct: 8 VERLDRPALKALQLQRLRDLLSHAYAHVPHTRAAFDAAGIKPDDLRHLEDLARFPFTVKA 67 Query: 74 DLRDNYPFGLFAVPREQVVRVHASSGTTGKPTVVGYTARDIDTWANVTARSIRAAGGRPG 133 DLRDNYPFGLFAVPRE+VVR+HASSGTTG+PTVVGYT DID WA + ARS+ A G RPG Sbjct: 68 DLRDNYPFGLFAVPREKVVRLHASSGTTGRPTVVGYTQADIDIWAGLMARSLAATGIRPG 127 Query: 134 DTLHNAFGYGLFTGGLGIHYGAERLGCMVVPMSGGQTEKQVQLIRDFEPKIILVTPSYML 193 D +HNA+GYGLFTGGLG HYGAERLGC VVPMSGG TEKQ+ LI DF + + TPSY L Sbjct: 128 DVVHNAYGYGLFTGGLGFHYGAERLGCSVVPMSGGNTEKQIGLISDFGARALAATPSYAL 187 Query: 194 NLIDEMVRQGMDPAESSLKIGIFGAEPWTQALRNEVETRVGIDALDIYGLSEVMGPGVAC 253 N+ + + G+ AES L +G+FGAEPW++++R E++ R+GI A D+YGLSE+MGPGVA Sbjct: 188 NIAEVAEQMGVSLAESPLAVGVFGAEPWSESMRAELDRRLGIKACDMYGLSEIMGPGVAI 247 Query: 254 ECVETKDGPVIWEDHFYPEIIDPVTGEVLPDGSQGELVFTSLTKEAMPVIRYRTRDLTAL 313 EC E + G WEDHF E++DP T E LP G++GELV T+LTK+A+P++RYRTRD+T L Sbjct: 248 EC-EHRVGLHGWEDHFLFEVVDPETLEPLPMGAEGELVITTLTKQALPMVRYRTRDITRL 306 Query: 314 L-PPTA--RAMRRLAKITGRSDDMLIVRGVNVFPSQIEEIVVALPLLSGQFQITLSRDGH 370 P A R R+ ++TGR+DDM+I+RGVNV+PSQIE +V ++ +Q+TL+R G Sbjct: 307 TDEPCACGRTHLRILRVTGRNDDMMIIRGVNVYPSQIEAALVGFAGVAPHYQLTLTRQGS 366 Query: 371 MDRLDLAVELRSEAAASVTDGERAALARELQHRIKTMVGVSSGVTVLAAGGIPATATGKA 430 +D L + E+ S + +RA LAR+++H +K++VG+S V V G +P + GKA Sbjct: 367 LDHLTVEAEVED----SRGEDDRAHLARQVRHHLKSLVGISCEVIVRLPGELP-RSQGKA 421 Query: 431 RRVIDRRQAA 440 RV D R+ A Sbjct: 422 VRVRDLRKQA 431 Lambda K H 0.319 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 601 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 440 Length of database: 432 Length adjustment: 32 Effective length of query: 408 Effective length of database: 400 Effective search space: 163200 Effective search space used: 163200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory