GapMind for catabolism of small carbon sources

 

Aligments for a candidate for padH in Magnetospirillum magneticum AMB-1

Align NADH-dependent phenylglyoxylate dehydrogenase subunit epsilon; Phenylglyoxylate:NAD oxidoreductase; Phenylglyoxylate:acceptor oxidoreductase; EC 1.2.1.58 (characterized)
to candidate WP_011384088.1 AMB_RS08490 FAD-dependent oxidoreductase

Query= SwissProt::Q8L3B0
         (421 letters)



>lcl|NCBI__GCF_000009985.1:WP_011384088.1 AMB_RS08490 FAD-dependent
           oxidoreductase
          Length = 411

 Score =  389 bits (998), Expect = e-112
 Identities = 205/414 (49%), Positives = 277/414 (66%), Gaps = 9/414 (2%)

Query: 9   KYLIAGSSHAALEAINAIRMHDAEGPITVVTRDAHLPYSPTVLPYVVSGKSAPERIFLRD 68
           KYL+ GSSHAALEA+ AIR+ D +G + ++TRD  LPYSPT+LPYVVSG+SAP+++ LRD
Sbjct: 6   KYLLVGSSHAALEALRAIRLVDPDGSMAMLTRDDRLPYSPTILPYVVSGRSAPDKVLLRD 65

Query: 69  DDFFARNKVAYRPKAALKALHADRNTAELADGSSVVYEKLLLATGASPAIPPIPGIDTVS 128
             FFA N  AY P A   +L A      L +G    Y+ LL+A+GA+PAIPP+ G+D V+
Sbjct: 66  PAFFAANNCAYVPNARAVSLDAKARAVTLENGEVWRYQSLLIASGAAPAIPPVKGLDGVT 125

Query: 129 YHVLRTLDDALKLRGAIAESKQAVVLGAGLVGMHAAENLVKAGATVTIVEMSEQLTSGYF 188
           YHVLR+L DA  LRGA+  +K AVVLGAGLVG+HAAEN+ +AG  VT+VEM   +  GYF
Sbjct: 126 YHVLRSLADAEGLRGAMGAAKTAVVLGAGLVGLHAAENMAEAGLKVTVVEMQGHVLPGYF 185

Query: 189 DKVAADMIEQAFRDAGGKIMTGSRVVRLEPTAAGAKLTLENGTTLEADLLLVATGVKPEM 248
           D  A+  IE AF   G ++  G +VV + P     K+ +++GTT+ ADLLLVATGV+P  
Sbjct: 186 DAKASTRIEDAFTTHGVELKLGRKVVEVAP----GKVMVDDGTTIAADLLLVATGVRPVT 241

Query: 249 DYLNGSGVEHAQGILVDDRMQTTAENVWAAA-TAQARGFFTGTKVMNAILPDATIQGRVA 307
           D+L GSGV   +G++VD+ M+T  + VWAA   AQA  F +G K +  I+P A  QG++A
Sbjct: 242 DWLEGSGVLVDRGVVVDEAMRTNIDGVWAAGDVAQATDFASGNKALIGIIPTAVEQGKIA 301

Query: 308 GMAMAGDPGVKDYAGAVPLNTYHFFGRHAISVGSSTVPEGGEVVTRFDEKTGRYLKAIFA 367
           G  MAGD   KDYAG +P+NTY FFGR A+S+G +   +G E V   +  +G Y + +  
Sbjct: 302 GQGMAGDSYRKDYAGGLPVNTYRFFGRVALSIGRAAATDGVEAV---ETASGAYRRLVLE 358

Query: 368 ADGPLTGIFGVNEFFDGGVMAQLILRRTDLTPLRSRFVANPLAVGREIMSQTWR 421
            +  L G   V+E FD G+M +LI RR DL+  +  F+A P+  GR +MS+ WR
Sbjct: 359 GN-RLVGYASVDEPFDVGIMGELIRRRVDLSECKDAFLARPVETGRRLMSEQWR 411


Lambda     K      H
   0.318    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 454
Number of extensions: 18
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 421
Length of database: 411
Length adjustment: 31
Effective length of query: 390
Effective length of database: 380
Effective search space:   148200
Effective search space used:   148200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory