Align Putative branched-chain alpha keto acid dehydrogenase E1 subunit beta (characterized, see rationale)
to candidate WP_011384714.1 AMB_RS11710 pyruvate dehydrogenase complex E1 component subunit beta
Query= uniprot:G1UHX5 (328 letters) >NCBI__GCF_000009985.1:WP_011384714.1 Length = 452 Score = 207 bits (527), Expect = 4e-58 Identities = 125/325 (38%), Positives = 177/325 (54%), Gaps = 6/325 (1%) Query: 5 TMAKALNTALRDALRDDPRTILFGEDIGALGGVFRITDGLAAEFGDERCFDTPLAESAIL 64 T+ +AL A+ + +R DP L GE++ G ++++ GL EFG ER DTP+ E Sbjct: 130 TVREALRDAMAEEMRADPNVFLMGEEVAQYQGAYKVSQGLLDEFGAERVIDTPITEMGFA 189 Query: 65 GTAVGMAMYGYRPVVEMQFDAFAYPAFEQLVSHVAKLRNRTRGAIGLPLTIRIPYGGGIG 124 G A G G +P+VE F+ A + +++ AK + G + R P G Sbjct: 190 GLACGAGYAGLKPIVEFMTMNFSMQAIDHVINSAAKTLYMSGGQQPCSIVFRGPNGAASR 249 Query: 125 GVEHHSDSSEIYYMATPGLTVVTPATAADAYSLLRRSIASPDPVVFLEPKRLYWRKEALG 184 HS +Y PGL V+ P +AADA LL+ +I P+PVVFLE + LY ++ Sbjct: 250 VGAQHSQDYASWYAHCPGLKVLAPWSAADAKGLLKAAIRDPNPVVFLENELLY--GQSFD 307 Query: 185 LPVDTG---PLGSAVIRRHGTHATLIAYGPAVTTALEAAEAAAEHGWDLEVIDLRTLMPL 241 +P D P+G A I R G H T+ AY V AL+AAE G + EVI+LR++ PL Sbjct: 308 VPDDPDFVLPIGKAKIERAGAHVTITAYSRMVQVALDAAEILKAEGIEAEVINLRSIRPL 367 Query: 242 DDATVCASVRRTGRAVVVHEAHGFAGPGAEIAARITERCFYHLEAPVRRVTGFDVPYP-P 300 D AT+ ASV++T R V V E AG G+EIAA + E+ F L+APV RV G DVP P Sbjct: 368 DVATIVASVQKTNRIVSVEEGWPVAGIGSEIAALMMEQAFDWLDAPVVRVAGADVPMPYA 427 Query: 301 PLLERHYLPGVDRILDAVASLEWEA 325 LE+ LP ++ ++ A S+ + A Sbjct: 428 ANLEKLALPQIEHVVAAARSVCYRA 452 Lambda K H 0.322 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 452 Length adjustment: 30 Effective length of query: 298 Effective length of database: 422 Effective search space: 125756 Effective search space used: 125756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory