Align BadI (characterized)
to candidate WP_011384978.1 AMB_RS13070 enoyl-CoA hydratase
Query= metacyc::MONOMER-892 (260 letters) >NCBI__GCF_000009985.1:WP_011384978.1 Length = 256 Score = 106 bits (265), Expect = 4e-28 Identities = 86/262 (32%), Positives = 124/262 (47%), Gaps = 19/262 (7%) Query: 4 EDLIYEIRNGVAWIIINRPDKMNAFRGTTCDELIKALYKAGYDKDVGAIVLAGAGDRAFC 63 E L+ + + V + INRPD NA G L + + G D V AIV+ G AF Sbjct: 3 EVLLEKPFDSVVLLRINRPDAKNALNGEVRRLLAEHMTTLGADPSVRAIVMTG-NQEAFA 61 Query: 64 TGGDQSTHDGNYDGRGTVGLPMEELHT---AIRDVPKPVIARVQGYAIGGGNVLATICDL 120 G D + G + L H AI + PKPVIA V GYA GGG L D+ Sbjct: 62 AGADIK----DMAEVGAIELMQRNNHLLWRAIANCPKPVIAAVNGYAWGGGCELVMHADI 117 Query: 121 TICSEKAIFGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWYMCKRYSGKEAEAMGLANL 180 + E A F Q K+G + GT L R VG+ KA + + SG EA MGLA++ Sbjct: 118 IVAGENASFSQPEVKVGIMPGAGGTQRLTRAVGKFKAMLMVMTGQAISGVEAGQMGLASV 177 Query: 181 CVPHDELDAEVQKWGEELCERSPTALA------IAKRSFNMDTAHQAGIAGMGMYALKLY 234 VP E+ + + + + P A+A +A + ++DTA + A +L Sbjct: 178 VVPDAEVVDKALEIAKTISRMPPVAIAQIKEVLLAGQDASLDTALM-----LERKAFQLL 232 Query: 235 YDTDESREGVKALQEKRKPEFR 256 + + + +EG+KA EKRKP ++ Sbjct: 233 FASADQKEGMKAFIEKRKPTYQ 254 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 256 Length adjustment: 24 Effective length of query: 236 Effective length of database: 232 Effective search space: 54752 Effective search space used: 54752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory