GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bamH in Magnetospirillum magneticum AMB-1

Align Benzoyl-CoA reductase electron transfer protein, putative (characterized, see rationale)
to candidate WP_011385160.1 AMB_RS13985 NADH-quinone oxidoreductase subunit NuoF

Query= uniprot:Q39TW5
         (635 letters)



>lcl|NCBI__GCF_000009985.1:WP_011385160.1 AMB_RS13985 NADH-quinone
           oxidoreductase subunit NuoF
          Length = 427

 Score =  281 bits (720), Expect = 3e-80
 Identities = 150/380 (39%), Positives = 227/380 (59%), Gaps = 6/380 (1%)

Query: 175 VMGEIKKSNLRGRGGGGFPAWRKWE--ESRNAPDPIKYVIVNADEGDPGAFMDRALIEGN 232
           ++ E+K S LRGRGG GFP   KW        P P  Y+++NADEG+PG   DR ++  +
Sbjct: 43  IIEEMKNSGLRGRGGAGFPTGVKWSFMPKTEGPRP-HYLVINADEGEPGTCKDREMMRFD 101

Query: 233 PHSILEGLIIGAYAVGAHEGFIYVRQEYPLAVENINLAIRQASERGFVGKDILGSGFDFT 292
           PH ++EG +I ++A+GAH  +IY+R E+    E++N+AI +A   G +G +  GSG+D  
Sbjct: 102 PHKLIEGALIASFAIGAHAAYIYIRGEFVREAEHLNIAIDEARAAGLLGPNACGSGWDCE 161

Query: 293 VKVHMGAGAFVCGESSALMTALEGRAGEPRPKYIHTAVKGVWDHPSVLNNVETWANVTQI 352
           V VH GAGA++CGE SAL+ +LEG+ G+PR K    A  G++  P+ +NNVE+ A    I
Sbjct: 162 VYVHRGAGAYICGEESALIESLEGKKGQPRLKPPFPAGVGLYGCPTTVNNVESIAVAPTI 221

Query: 353 ITKGADWFTSYGTAGSTGTKIFSLVGKITNTGLVEVPMGVTLRDIITKVGGGIPGG-KKF 411
           + +GA WF+  G   +TGTK+F + G +     VE  MG+ L+++I K  GG+ GG    
Sbjct: 222 LRRGAAWFSGLGKPNNTGTKVFCISGHVNTPCNVEEEMGIPLKELIEKHAGGVRGGWDNL 281

Query: 412 KAVQTGGPSGGCIPEAML-DLPVDFDELTKAGSMMGSGGMIVMDEDTCMVDIARYFIDFL 470
            A+  GG S   + +    ++ +DFD L    S +G+  ++VMD+ T +V        F 
Sbjct: 282 LAIIPGGSSVPMLTKQQCEEVTMDFDALRAMRSGLGTAAVMVMDKSTDLVRAIHRLSRFY 341

Query: 471 KDESCGKCTPCREGIRQMLAVLTRITVGKGKEGDIELLEELA-ESTGAALCALGKSAPNP 529
             ESCG+CTPCREG   M  ++ R+  G  +  +I+LLEE++ +  G  +CALG +A  P
Sbjct: 342 WHESCGQCTPCREGTGWMSRMMGRMVTGDAELSEIDLLEEISRQIEGHTICALGDAAAWP 401

Query: 530 VLSTIRYFRDEYEAHIREKK 549
           +   IR FR E E  I +++
Sbjct: 402 IQGLIRAFRPEMERRILDRQ 421


Lambda     K      H
   0.319    0.138    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 763
Number of extensions: 41
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 635
Length of database: 427
Length adjustment: 35
Effective length of query: 600
Effective length of database: 392
Effective search space:   235200
Effective search space used:   235200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory