GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bamH in Magnetospirillum magneticum AMB-1

Align Benzoyl-CoA reductase electron transfer protein, putative (characterized, see rationale)
to candidate WP_050750753.1 AMB_RS17165 NADP oxidoreductase

Query= uniprot:Q39TW5
         (635 letters)



>lcl|NCBI__GCF_000009985.1:WP_050750753.1 AMB_RS17165 NADP
           oxidoreductase
          Length = 619

 Score =  268 bits (686), Expect = 4e-76
 Identities = 162/491 (32%), Positives = 244/491 (49%), Gaps = 46/491 (9%)

Query: 61  VNTKGTGCPGFCERGPIVMIYPEGICYLKVKPEDVPEIVSHTIKEKKVVDRLLYEDPATG 120
           V+   T C G C++GP +++    I  +  +  D            ++V+ + ++ P   
Sbjct: 119 VSVDTTSCTGLCDQGPALLVNYRPITRMTAQRVD------------QIVELIRHKTP--- 163

Query: 121 TRALRESDIPFYKNQQRNILSENLRLDSKSMDDYLAIGGYSALSKVLFQMTPEDVMGEIK 180
              L E    F+K      + +N+R     +    A G      K     +P++V+  +K
Sbjct: 164 ---LAEWPAEFFK------VEDNIRRKDALLGADFAPGDALKALK-----SPQEVLDSVK 209

Query: 181 KSNLRGRGGGGFPAWRKWEESRNA----PDPIKYVIVNADEGDPGAFMDRALIEGNPHSI 236
           +S LRGRGG GF   +KW+  R A    P    YV+ NADEG+PG F DR L+      +
Sbjct: 210 ESGLRGRGGAGFSTGQKWDFCRAAVGTGPHAAHYVVCNADEGEPGTFKDRVLLASYAGLV 269

Query: 237 LEGLIIGAYAVGAHEGFIYVRQEYPLAVENINLAIRQASERGFVGKDILG-SGFDFTVKV 295
            EG+ +  Y +GA +G +Y+R EY   +E +N  + +      +GK ILG +GFDF ++V
Sbjct: 270 FEGMTVSGYVIGARKGIVYLRGEYRYLLEPLNAVLEKRRAAKLLGKSILGRTGFDFDIEV 329

Query: 296 HMGAGAFVCGESSALMTALEGRAGEPRPKYIHTAVKGVWDHPSVLNNVETWANVTQIITK 355
           H+GAGA+VCGE +AL+ +LEG+ G PR +       G    P+ +NNVET A+   I  K
Sbjct: 330 HLGAGAYVCGEETALLESLEGKRGVPRKRPPFPVTAGYLGQPTAVNNVETLASAALIAAK 389

Query: 356 GADWFTSYGTAGSTGTKIFSLVGKITNTGLVEVPMGVTLRDIITKVGGGIPGGKKFKAVQ 415
           GA W+ S GT  S GTKI S+ G     G+ E P GV +  ++        G +  +A Q
Sbjct: 390 GAAWYKSIGTPKSAGTKILSISGDCERPGIYEYPYGVKVSQVLADC-----GARDTQACQ 444

Query: 416 TGGPSGGCIPEAMLDLPVDFDELTKAGSMMGSGGMIVMDEDTCMVDIARYFIDFLKDESC 475
             G SG C+        + F+++   GS M      + D    M  +AR F  F   ESC
Sbjct: 445 IAGASGLCVAPNEFGRRIAFEDIPTGGSFM------IFDNTRDMFQVARNFAHFFVHESC 498

Query: 476 GKCTPCREGIRQMLAVLTRITVGKGKEGDI-ELLEELAESTGAALCALGKSAPNPVLSTI 534
           G CTPCR G   +   + +I  G G E DI ++   +     A+ C LG++A N V  T+
Sbjct: 499 GFCTPCRVGTTLLANAMDKIDEGHGGEYDINDIWRVIRTLKTASHCGLGQTAGNAVADTL 558

Query: 535 RYFRDEYEAHI 545
           + FR  YE  +
Sbjct: 559 QKFRPSYELRL 569


Lambda     K      H
   0.319    0.138    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1024
Number of extensions: 57
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 635
Length of database: 619
Length adjustment: 38
Effective length of query: 597
Effective length of database: 581
Effective search space:   346857
Effective search space used:   346857
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory