Align Iron-sulfur cluster-binding protein, putative (characterized, see rationale)
to candidate WP_011385159.1 AMB_RS13980 NADH-quinone oxidoreductase subunit G
Query= uniprot:Q39TW6 (218 letters) >NCBI__GCF_000009985.1:WP_011385159.1 Length = 690 Score = 98.6 bits (244), Expect = 3e-25 Identities = 66/202 (32%), Positives = 98/202 (48%), Gaps = 30/202 (14%) Query: 6 LQIDGKEVVATEGMTILDAAKSVGISIPTLCHHEKLEPYGGCRICTVEVEVRGWPKLVAG 65 L IDG+E+ G TI+ AA +GI IP C+HE+L G CR+C VEVE PK A Sbjct: 4 LTIDGREIEVEAGTTIIQAADLLGIEIPRFCYHERLAIAGNCRMCLVEVE--KMPKPAAS 61 Query: 66 CIYPVEKGLVVRTRNEKIDKIRKVLLEEMLAHAP---------DSEELKALAQEYGADRD 116 C PV +G+VV+T + K R+ ++E +L + P +L+ A YG+D++ Sbjct: 62 CAMPVGEGMVVKTNTPAVRKARQGVMEFLLLNHPLDCPICDQGGECDLQDQAMAYGSDKN 121 Query: 117 RFEKHP----------------SFCIHCGLCVRYCAEIKKKNAVGFVDRGSNREIS-FIP 159 R ++ + CI C CVR+ +EI +G + RG + EI ++ Sbjct: 122 RCKEGKRAVPDKDYGPLVQTMMTRCIQCTRCVRFISEIAGTPVLGGLGRGEHLEIGRYVG 181 Query: 160 EIAAKECWDCKECFPLCPTSAL 181 + E LCP AL Sbjct: 182 AAVSSEL--SGNLIDLCPVGAL 201 Lambda K H 0.320 0.137 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 218 Length of database: 690 Length adjustment: 30 Effective length of query: 188 Effective length of database: 660 Effective search space: 124080 Effective search space used: 124080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory