GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bcrA in Magnetospirillum magneticum AMB-1

Align Benzoyl-CoA reductase subunit A; 3-hydroxybenzoyl-CoA reductase subunit alpha; EC 1.3.7.8; EC 1.3.99.n1 (characterized)
to candidate WP_011384538.1 AMB_RS10810 benzoyl-CoA reductase subunit A

Query= SwissProt::O87876
         (438 letters)



>lcl|NCBI__GCF_000009985.1:WP_011384538.1 AMB_RS10810 benzoyl-CoA
           reductase subunit A
          Length = 430

 Score =  624 bits (1610), Expect = 0.0
 Identities = 315/436 (72%), Positives = 361/436 (82%), Gaps = 7/436 (1%)

Query: 1   MECFVGIDLGSTTTKAVVMDDKGQVLGRGITNSRSNYDTAARVSKLEAFIDARLSLIRRE 60
           M CF+GIDLGSTTTKAVVMD+  Q+LGRGITNSRSNYDTAA VSK EA ID RL+L RR 
Sbjct: 1   MRCFIGIDLGSTTTKAVVMDENLQILGRGITNSRSNYDTAAAVSKQEALIDTRLTLFRRA 60

Query: 61  LDKEPAVAGRVDEIIDGLTRNFRREQFIEQLGDLEQTCVANVEGPRFAGKEKAIVGALTE 120
           L   P V+G+VD+I+  L RNFR  QF+EQL DL+ TC+AN++GPRFAG+EK ++ AL  
Sbjct: 61  LSNVPEVSGKVDDILSDLERNFRHVQFLEQLEDLQNTCIANIKGPRFAGREKVVIEALEG 120

Query: 121 VFRRLREEEADKLFAPDAQRKSDFFRDLAGSRFMQIGEEVARANGVEFDHLLHMYDKSII 180
            F RLR+  A + +AP  +RKSDFFRDLAG+ FM  GE V +  G+ FD +L++YDKSII
Sbjct: 121 TFSRLRDSSAAQ-YAPGVKRKSDFFRDLAGAEFMSHGEAVCKEAGLGFDLILNVYDKSII 179

Query: 181 EVENRPPSADMNRKFRSAMERVRGEMSSALDTAALGAPIDAALEIDMSERYVVGTGYGRV 240
           EVENRPP+ DM  KF  A+E+     SS L      AP+ +AL I + E YVVGTGYGRV
Sbjct: 180 EVENRPPAGDMEGKFVRALEKGTMTGSSIL------APVQSALAIPLEETYVVGTGYGRV 233

Query: 241 RLPFPKEHIRSEILCHGLGAHLMYPKTRTVLDIGGQDTKGIQIDDKGIVVNFQMNDRCAA 300
           RLPFPKEHIRSEILCHGLGAH+MYP TRTVLDIGGQDTKGIQ+D  GIV NFQMNDRCAA
Sbjct: 234 RLPFPKEHIRSEILCHGLGAHMMYPDTRTVLDIGGQDTKGIQVDPVGIVENFQMNDRCAA 293

Query: 301 GTGRYLGYVADEMNMGLHELGPLAMKSTKSIRINSTCTVFAGAELRDRLALGDKREDILA 360
           G GRYLGY+ADEMNMGLHELGPLAMKS K +RINSTCTVFAGAELRDRLALG+KREDILA
Sbjct: 294 GCGRYLGYIADEMNMGLHELGPLAMKSNKQVRINSTCTVFAGAELRDRLALGEKREDILA 353

Query: 361 GLHRAIMLRAMSIISRSGGITDQFTFTGGVAKNEAAVKELRQLVKENYGEVQINIDPDSI 420
           GLHRAI+LRAMSI+SR+GG+ DQFTFTGGVAKNEAAV+ELR+L+KENYG+V INIDPDSI
Sbjct: 354 GLHRAIILRAMSILSRAGGVKDQFTFTGGVAKNEAAVRELRKLIKENYGDVTINIDPDSI 413

Query: 421 YTGALGASEFARRAVV 436
           YTGALG + FA RAVV
Sbjct: 414 YTGALGGATFAVRAVV 429


Lambda     K      H
   0.320    0.137    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 609
Number of extensions: 20
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 438
Length of database: 430
Length adjustment: 32
Effective length of query: 406
Effective length of database: 398
Effective search space:   161588
Effective search space used:   161588
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory