Align Crotonyl-CoA hydratase; EC 4.2.1.150 (characterized)
to candidate WP_011382625.1 AMB_RS00905 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase
Query= SwissProt::Q0AVM1 (260 letters) >NCBI__GCF_000009985.1:WP_011382625.1 Length = 261 Score = 134 bits (338), Expect = 1e-36 Identities = 85/258 (32%), Positives = 133/258 (51%), Gaps = 6/258 (2%) Query: 4 ENIILEKEEKLAVLYINRPKAMNALNKDTLLEIKDAVTAVNDDPAVELLIITGSGDKSFV 63 E I++ + + + +NRP +NA N + ++ AV +D L+ITG+G K F Sbjct: 3 ETILVARTGDVTTITLNRPGRINAFNVEMHGALRSAVAHAAED-GTRCLVITGAG-KGFC 60 Query: 64 AGADIAFMQNLSAMEAREFGAL----GQKVFRLIEAMEKPVIAAVNGFALGGGCELAMCC 119 AG D++ + + GA + R ++A+ PVIAAVNG A G G LA+ C Sbjct: 61 AGQDLSDRVSKPGDPPPDLGASLDARYNPLIRSLKALPMPVIAAVNGTAAGAGANLALAC 120 Query: 120 DFRIAASNAKFGQPEVGLGITPGFGGTQRLPRLVGPGMAKQLLYTADVINADEAFRIGLV 179 D +AA +A F Q +G+ P GGT LPRLVG A L+ + + A++A + G++ Sbjct: 121 DIVVAARSAAFVQSFCKVGLIPDSGGTWTLPRLVGTARATALMMLGEKVTAEQAMQWGMI 180 Query: 180 NKVVQPEELLPEVKKIAGRILSKGQLAVRLSKAAANEGMQTDIDRAMSIEADAFGLCFAT 239 + V E+LLP V +A ++ ++ + L K A +D + +E D T Sbjct: 181 WRCVDDEQLLPTVLAMAAQLAAQPTRGLALMKKALARSGANTLDAQLDLERDLQTEAGCT 240 Query: 240 QDQKEGMTAFLEKRKANF 257 QD +EG+ AF+EKR F Sbjct: 241 QDYQEGVRAFMEKRPPRF 258 Lambda K H 0.319 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 261 Length adjustment: 25 Effective length of query: 235 Effective length of database: 236 Effective search space: 55460 Effective search space used: 55460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory