GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gcdH in Magnetospirillum magneticum AMB-1

Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate WP_011385596.1 AMB_RS16315 acyl-CoA dehydrogenase

Query= BRENDA::Q3JP94
         (395 letters)



>lcl|NCBI__GCF_000009985.1:WP_011385596.1 AMB_RS16315 acyl-CoA
           dehydrogenase
          Length = 392

 Score =  574 bits (1480), Expect = e-168
 Identities = 278/389 (71%), Positives = 327/389 (84%), Gaps = 1/389 (0%)

Query: 6   FHWDDPLLLDQQLADDERMVRDAAHAYAQGKLAPRVTEAFRHETTDAAIFREMGEIGLLG 65
           F WDDP LL+ QL++DE+++RD+AHAY Q KL PRV +AFR ET D  I  EMGE+GLLG
Sbjct: 4   FKWDDPFLLEDQLSEDEKLIRDSAHAYCQEKLQPRVMKAFRDETFDREIMNEMGEMGLLG 63

Query: 66  PTIPEQYGGPGLDYVSYGLIAREVERVDSGYRSMMSVQSSLVMVPIFEFGSDAQKEKYLP 125
           PTIPE+YGGPG+++V+YGLI+REVERVDSGYRS MSVQSSLVM PIF +G++ QK+KYLP
Sbjct: 64  PTIPEEYGGPGVNHVAYGLISREVERVDSGYRSAMSVQSSLVMHPIFSYGTEEQKKKYLP 123

Query: 126 KLATGEWIGCFGLTEPNHGSDPGSMVTRARKVPGGYSLSGSKMWITNSPIADVFVVWAKL 185
           +LATGE IGCFGLTEP+ GSDPG M TRA+KV GGY L+GSKMWITNSPI+D+ +VWAK 
Sbjct: 124 RLATGEIIGCFGLTEPDAGSDPGGMRTRAKKVDGGYLLTGSKMWITNSPISDIAIVWAKS 183

Query: 186 DEDGRDEIRGFILEKGCKGLSAPAIHGKVGLRASITGEIVLDEAFVPEENILPHVKGLRG 245
           D     +I+GFI+EKG KG + P I GK+ LRASITGEIVLDEAFVP+E ++P+  GL G
Sbjct: 184 DAH-EGKIKGFIVEKGIKGFTTPKIEGKLSLRASITGEIVLDEAFVPDEALMPNASGLGG 242

Query: 246 PFTCLNSARYGIAWGALGAAESCWHIARQYVLDRKQFGRPLAANQLIQKKLADMQTEITL 305
           PF CLN ARYGIAWG +GAAE CWH ARQY+LDRKQFGRPLAANQ+ Q KLA+M TEITL
Sbjct: 243 PFGCLNKARYGIAWGVIGAAEFCWHAARQYMLDRKQFGRPLAANQIPQLKLANMMTEITL 302

Query: 306 GLQGVLRLGRMKDEGTAAVEITSIMKRNSCGKALDIARLARDMLGGNGISDEFGVARHLV 365
           GLQ  +R+GRM D+ T A E  S++KRN+CGKALDIAR+ARDM GGNGIS+EF V RH+V
Sbjct: 303 GLQACVRVGRMMDDHTWAPEAVSLIKRNNCGKALDIARMARDMHGGNGISEEFHVIRHMV 362

Query: 366 NLEVVNTYEGTHDIHALILGRAQTGIQAF 394
           NLE VNTYEG HD+HALILGRA TGIQAF
Sbjct: 363 NLETVNTYEGAHDVHALILGRAMTGIQAF 391


Lambda     K      H
   0.320    0.138    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 534
Number of extensions: 14
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 395
Length of database: 392
Length adjustment: 31
Effective length of query: 364
Effective length of database: 361
Effective search space:   131404
Effective search space used:   131404
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory