Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_011384970.1 AMB_RS13030 enoyl-CoA hydratase
Query= BRENDA::Q5SLK3 (254 letters) >NCBI__GCF_000009985.1:WP_011384970.1 Length = 272 Score = 137 bits (346), Expect = 2e-37 Identities = 86/250 (34%), Positives = 130/250 (52%), Gaps = 6/250 (2%) Query: 10 VLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDLTEFGDR 69 V LTLNRP++ N +T + L + +V+A+++TG+G F +G D+ E Sbjct: 22 VATLTLNRPDRKNPLTFDSYGELRDLFENMVYADDVKAVIVTGSGGNFCSGGDVHEIIGP 81 Query: 70 -----KPDYEAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASF 124 P+ R V A+ +P++ A++G+ AGAG L D+RL + Sbjct: 82 LTKMDMPELLEFTRMTGDAVRAMRNAPQPIIAAIDGICAGAGTMLGCASDIRLGTARSKV 141 Query: 125 TTAFVRIGLV-PDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLM 183 FVR+GL D G LLPRL+GL++A ELL + EEA +G + + E+L+ Sbjct: 142 AFLFVRVGLAGADMGACTLLPRLIGLSRAAELLYTGRAMGGEEAERVGYYNSLHAPEELL 201 Query: 184 EEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVRAF 243 + A LA+ LA GPT +A+TKK+L + + L E + EA Q QT+D E AF Sbjct: 202 DAANKLAQSLANGPTFGHAMTKKMLWQEWNHGLGECIEAEAQAQAICMQTKDFERAYVAF 261 Query: 244 REKRPPRFQG 253 K+ P F+G Sbjct: 262 ANKQAPVFEG 271 Lambda K H 0.318 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 272 Length adjustment: 25 Effective length of query: 229 Effective length of database: 247 Effective search space: 56563 Effective search space used: 56563 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory