GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaK in Magnetospirillum magneticum AMB-1

Align Phenylacetate-coenzyme A ligase; Phenylacetyl-CoA ligase; PA-CoA ligase; EC 6.2.1.30 (characterized)
to candidate WP_011385134.1 AMB_RS13855 phenylacetate--CoA ligase

Query= SwissProt::Q9L9C1
         (440 letters)



>lcl|NCBI__GCF_000009985.1:WP_011385134.1 AMB_RS13855
           phenylacetate--CoA ligase
          Length = 442

 Score =  629 bits (1621), Expect = 0.0
 Identities = 308/434 (70%), Positives = 358/434 (82%), Gaps = 3/434 (0%)

Query: 6   PSPGDLEPIEKASQDELRALQLERLKWSVRHAYENVPHYRKAFDAKGVHPDDLKSLADLA 65
           P+   L+PIE AS+D++ ALQ ER+KWS+ HAY NV HYR     KGVHPDD K L DLA
Sbjct: 11  PAKDLLDPIEIASRDQITALQTERMKWSLTHAYNNVEHYRNKCREKGVHPDDFKELKDLA 70

Query: 66  KFPFTAKGDLRDNYPFGMFAVPREKVARVHASSGTTGKPTVVGYTLKDIDTWATVVARSI 125
           KFPFT K DLRD YPFGMFAVP ++V RVHASSGTTGKPTVVGYT  DID WA V+ARSI
Sbjct: 71  KFPFTTKSDLRDTYPFGMFAVPMDEVVRVHASSGTTGKPTVVGYTQNDIDMWANVMARSI 130

Query: 126 RASGGRAGDMVHIAYGYGLFTGGLGAHYGAEKLGCTVVPMSGGQTEKQIQLIQDFKPDII 185
           RA+GGR  D  H++YGYGLFTGGLGAHYGAE+LGCTV+PMSGGQTEKQIQLI DFKP+II
Sbjct: 131 RAAGGRRSDKCHVSYGYGLFTGGLGAHYGAERLGCTVIPMSGGQTEKQIQLIMDFKPEII 190

Query: 186 MVTPSYMLTVLDEMERMGIDPHQTSLKVGIFGAEPWTQAMRAAMEARAGIDAVDIYGLSE 245
           MVTPSYML + DEM+R GID     L+VGIFGAEPWT AMR  +E R GI+AVDIYGLSE
Sbjct: 191 MVTPSYMLAIADEMDRQGIDTKTCPLQVGIFGAEPWTGAMREEIEVRMGIEAVDIYGLSE 250

Query: 246 VMGPGVANECIEAKDGPVIWEDHFYPEIIDPHTGEVLPDGSEGELVFTTLTKEAMPVIRY 305
           V+GPGVA EC+E KDG  +WEDHFYPEIIDPHTGEVLPDGS GELVFT+LTKEA+P+IRY
Sbjct: 251 VIGPGVACECVETKDGLHLWEDHFYPEIIDPHTGEVLPDGSMGELVFTSLTKEALPIIRY 310

Query: 306 RTRDLTRLLPPTARSMRRMAKITGRSDDMLIIRGVNLFPTQVEELICKNPKLAPQYLLEV 365
           RTRDLT+LLP TARSMRRM KITGRSDDMLIIRGVN+FPTQ+EELI K+ +LAP Y LEV
Sbjct: 311 RTRDLTQLLPGTARSMRRMGKITGRSDDMLIIRGVNVFPTQIEELILKDYRLAPHYQLEV 370

Query: 366 DKDGHMDTLTVKVEINPEANVGRHPEQKEALAKELQHDIKTFIGVSAKVHVCEPFAIERV 425
            +DGH+D++ V VE+   A+        EA +K+LQH IK++IG+S KV+V  P +IER 
Sbjct: 371 TRDGHLDSVAVNVEV--RADQPYDDSALEAASKDLQHHIKSYIGISTKVNVLAPNSIER- 427

Query: 426 TIGKAKRVVDRRPK 439
           ++GKA+RV+D+RPK
Sbjct: 428 SMGKARRVIDKRPK 441


Lambda     K      H
   0.318    0.137    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 708
Number of extensions: 20
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 440
Length of database: 442
Length adjustment: 32
Effective length of query: 408
Effective length of database: 410
Effective search space:   167280
Effective search space used:   167280
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

Align candidate WP_011385134.1 AMB_RS13855 (phenylacetate--CoA ligase)
to HMM TIGR02155 (paaF: phenylacetate-CoA ligase (EC 6.2.1.30))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02155.hmm
# target sequence database:        /tmp/gapView.31586.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02155  [M=422]
Accession:   TIGR02155
Description: PA_CoA_ligase: phenylacetate-CoA ligase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
   1.4e-225  734.6   0.1   1.5e-225  734.4   0.1    1.0  1  lcl|NCBI__GCF_000009985.1:WP_011385134.1  AMB_RS13855 phenylacetate--CoA l


Domain annotation for each sequence (and alignments):
>> lcl|NCBI__GCF_000009985.1:WP_011385134.1  AMB_RS13855 phenylacetate--CoA ligase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  734.4   0.1  1.5e-225  1.5e-225       1     422 []      20     439 ..      20     439 .. 0.98

  Alignments for each domain:
  == domain 1  score: 734.4 bits;  conditional E-value: 1.5e-225
                                 TIGR02155   1 eklsldelralqlerlkvsvkrayenvpayrkafdaagvkpddlkelsdlakfpltaksdlrdnypfdl 69 
                                               e +s+d+++alq+er+k+s+ +ay+nv +yr++  ++gv+pdd+kel+dlakfp+t+ksdlrd ypf++
  lcl|NCBI__GCF_000009985.1:WP_011385134.1  20 EIASRDQITALQTERMKWSLTHAYNNVEHYRNKCREKGVHPDDFKELKDLAKFPFTTKSDLRDTYPFGM 88 
                                               679****************************************************************** PP

                                 TIGR02155  70 lavprekvvrvhassGttGkptvvaytqkdldtwsevvarslraaGGrkgdllhnayGyGlftGGlGvh 138
                                               +avp+++vvrvhassGttGkptvv+ytq+d+d+w++v+ars+raaGGr+ d+ h++yGyGlftGGlG+h
  lcl|NCBI__GCF_000009985.1:WP_011385134.1  89 FAVPMDEVVRVHASSGTTGKPTVVGYTQNDIDMWANVMARSIRAAGGRRSDKCHVSYGYGLFTGGLGAH 157
                                               ********************************************************************* PP

                                 TIGR02155 139 yGaeklGatvvpisGGqtekqvqliqdfkpdiiavtpsyilalleelkrlgidpedislkvailGaepw 207
                                               yGae+lG+tv+p+sGGqtekq+qli dfkp+ii+vtpsy+la+++e++r+gid++ + l+v+i+Gaepw
  lcl|NCBI__GCF_000009985.1:WP_011385134.1 158 YGAERLGCTVIPMSGGQTEKQIQLIMDFKPEIIMVTPSYMLAIADEMDRQGIDTKTCPLQVGIFGAEPW 226
                                               ********************************************************************* PP

                                 TIGR02155 208 teamrkelearlgikaldiyGlseviGpGvanecvetkdGlviwedhfypeiidpetgevlpdGeeGel 276
                                               t amr+e+e r+gi+a+diyGlseviGpGva ecvetkdGl++wedhfypeiidp+tgevlpdG+ Gel
  lcl|NCBI__GCF_000009985.1:WP_011385134.1 227 TGAMREEIEVRMGIEAVDIYGLSEVIGPGVACECVETKDGLHLWEDHFYPEIIDPHTGEVLPDGSMGEL 295
                                               ********************************************************************* PP

                                 TIGR02155 277 vfttltkealpviryrtrdltrllpgtartmrrmdkikGrsddllilrGvnvfptqleevllkldklsp 345
                                               vft+ltkealp+iryrtrdlt+llpgtar+mrrm ki+Grsdd+li+rGvnvfptq+ee++lk  +l+p
  lcl|NCBI__GCF_000009985.1:WP_011385134.1 296 VFTSLTKEALPIIRYRTRDLTQLLPGTARSMRRMGKITGRSDDMLIIRGVNVFPTQIEELILKDYRLAP 364
                                               ********************************************************************* PP

                                 TIGR02155 346 hyqleltreGaldeltlkvelkdesaalrlleqksllakkiekkikaevgvsvdvelvepgslerseGk 414
                                               hyqle+tr+G+ld+++++ve++ ++   ++    ++ +k+++++ik+ +g+s++v++ +p s+ers+Gk
  lcl|NCBI__GCF_000009985.1:WP_011385134.1 365 HYQLEVTRDGHLDSVAVNVEVRADQPYDDSA--LEAASKDLQHHIKSYIGISTKVNVLAPNSIERSMGK 431
                                               **********************888777644..445799****************************** PP

                                 TIGR02155 415 akrvvdkr 422
                                               a+rv+dkr
  lcl|NCBI__GCF_000009985.1:WP_011385134.1 432 ARRVIDKR 439
                                               *******8 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (422 nodes)
Target sequences:                          1  (442 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02
# Mc/sec: 7.79
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory