Align Phenylacetyl-CoA:acceptor oxidoreductase-like protein subunit C, PadD; EC 1.8.5.3 (characterized, see rationale)
to candidate WP_011383655.1 AMB_RS06310 phenylacetyl CoA
Query= uniprot:A0A2R4BLZ0 (293 letters) >NCBI__GCF_000009985.1:WP_011383655.1 Length = 308 Score = 228 bits (580), Expect = 2e-64 Identities = 135/294 (45%), Positives = 177/294 (60%), Gaps = 10/294 (3%) Query: 2 RGVQPELQPFWDARAAGNFIGGGTGTGLLLWAVLAATAHDTALLPPLLLA-LACIGGGLF 60 +G+ P LQ WD RAAGNFIGGG+GTGLL+ A L A D LL+A LA +G GLF Sbjct: 14 QGLSPWLQTAWDLRAAGNFIGGGSGTGLLIIASLGA--FDGLYSRVLLIAGLALVGLGLF 71 Query: 61 CVWLEIGKPWRALNVFFHARTSWMTREAIVAMPLFAAGALAVLTGALAA-AWLAALVGLG 119 V+LEIG+P RALNV A+ SWMTREA+VA LF GA A++ L W+ A Sbjct: 72 SVFLEIGRPLRALNVLLGAKRSWMTREAMVAAVLFPLGAAALIWPDLTKLVWIPAAA--- 128 Query: 120 FLYCQARILQAARGIPAWREAALLPLVITTGLAEGAGLFALVAALLPQGPGTAFALPMLI 179 +LYCQARIL+AA+GIP WR +LPL I +GLAEGAG+ L+ L +G + L+ Sbjct: 129 YLYCQARILEAAKGIPTWRSPLILPLTIASGLAEGAGILLLLGTLALEGGAPEWVAGTLV 188 Query: 180 -LVVLRGWLWRRYRARLAAPDSAPLKAVRALDAEGRLFVPLGHYLPAVLLALALVLQGGA 238 + R ++W YR R+ + AP++A L F G+ +P L LA +Q Sbjct: 189 ATIAARIFVWMFYRRRMVGGE-APVEAAAVLIRFSMPFTLGGNVIPIAFLVLA-GIQPDI 246 Query: 239 ATALMALAGVAMAAAGWHFKLALITRIAYTQGFALTHVPARTPGHARPGVKPGW 292 A +A AG+A A GW K+ ++T+ A+ QGFA+ H PAR G + PG KPGW Sbjct: 247 RAAALAAAGLAAMAGGWAMKVVIVTKAAHNQGFAINHSPARGGGESGPGFKPGW 300 Lambda K H 0.328 0.140 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 308 Length adjustment: 27 Effective length of query: 266 Effective length of database: 281 Effective search space: 74746 Effective search space used: 74746 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory