Align NADH-dependent phenylglyoxylate dehydrogenase subunit gamma; Phenylglyoxylate:NAD oxidoreductase; Phenylglyoxylate:acceptor oxidoreductase; EC 1.2.1.58 (characterized)
to candidate WP_011384085.1 AMB_RS08475 hypothetical protein
Query= SwissProt::Q8L3B3 (190 letters) >NCBI__GCF_000009985.1:WP_011384085.1 Length = 190 Score = 230 bits (587), Expect = 1e-65 Identities = 109/190 (57%), Positives = 151/190 (79%) Query: 1 MYEVRFHGRGGQGSVMASGMLAAAMVEEGKYAVSIPSFGFERRGAPVVSFLRMSDREIRQ 60 M+EVR HGRGGQG+V+AS +LAAA+VEEG++ ++IP+FGFERRGAPVV+FLR+SD IR+ Sbjct: 1 MHEVRLHGRGGQGAVLASAILAAALVEEGRHVMAIPAFGFERRGAPVVAFLRLSDTVIRR 60 Query: 61 LTNIYQPDCIVCVDPTLTKSVDIFAGMKAGGTLVQATHHPLSELALPDCVSTVGLLDAVK 120 +TNIY PD +V +DPT+ ++VD++AGM GGTL+ AT E+ +P V V + +A+ Sbjct: 61 VTNIYSPDIVVVIDPTVVRAVDVYAGMPKGGTLILATSKVPGEIEVPPVVERVAVCNAIT 120 Query: 121 IALEIFKRPITNTLMLGAFAKTTGVVSLESLKRALEDSEFRDAGLAQNMTALERGYAEVA 180 IA++IFKR ITNT+MLGAFAK TG+VS++SL++ALE++ FRDAGL QN+ A+ RGYAE Sbjct: 121 IAMDIFKRQITNTIMLGAFAKATGLVSVDSLEKALEETHFRDAGLKQNIEAVRRGYAETQ 180 Query: 181 VHHIERRAAA 190 + + + A Sbjct: 181 ILDLAKEKVA 190 Lambda K H 0.321 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 190 Length of database: 190 Length adjustment: 20 Effective length of query: 170 Effective length of database: 170 Effective search space: 28900 Effective search space used: 28900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory