Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_011384081.1 AMB_RS08460 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A165KER0 (358 letters) >NCBI__GCF_000009985.1:WP_011384081.1 Length = 315 Score = 156 bits (394), Expect = 8e-43 Identities = 107/347 (30%), Positives = 173/347 (49%), Gaps = 47/347 (13%) Query: 3 NTKTNWIIGAVAL-LVLPLILQSFGNAWVRIADL-ALLYVLLALGLNIVVGYAGLLDLGY 60 N KT G AL +V+ L F N++ + A+ +L +GLN+++GYAG + LG+ Sbjct: 2 NLKTARTGGLAALAIVITLAPLGFSNSYFYDVGVNAMFNAILCVGLNLLIGYAGQISLGH 61 Query: 61 VAFYAVGAYLFALMASPHLADNFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLGAPT 120 F+A+GAY ++ + A ++A + ++ P Sbjct: 62 AGFFALGAYGSGILTERYGVPAIGALV----------------LSASVVGILAFVVARPI 105 Query: 121 LKLRGDYLAIVTLGFGEIIRIFLNNLDHPVNLTNGPKGLGQIDSVKVFGLDLGKRLEVFG 180 LKL+G YLA+ TLG G II I L +T GP G+ LG ++ G Sbjct: 106 LKLKGHYLAMATLGIGIIIHIVLKT---EAGITGGPDGMS-----------LGN-FKMLG 150 Query: 181 FDINSVTLYYYLFLVLVVVSVIICYRLQDSRIGRAWMAIREDEIAAKAMGINTRNMKLLA 240 F I ++Y++ VL+V++V + L +S +GRA A+ E+ A+ +G++T + K+L Sbjct: 151 FTIKGDQMWYWVTGVLLVLAVWLSLNLIESPVGRALRAVHGSEVGAEVVGVDTSSYKVLV 210 Query: 241 FGMGASFGGVSGAMFGAFQGFVSPESFSLMESVMIVAMVVLGGIGHIPGVILGAVLLSAL 300 F + A F V G++F GF++P+ S SV +V MVVLGG+ I G ++GAV+L+ L Sbjct: 211 FVVSAVFASVVGSLFAHKNGFITPDISSFFHSVELVTMVVLGGMASIYGALIGAVILTLL 270 Query: 301 PEVLRYVAGPLQAMTDGRLDSAILRQLLIALAMIIIMLLRPRGLWPS 347 P+VL V +++ M+ M+ P+GL PS Sbjct: 271 PQVLAAVEQ--------------YEAMILGAIMMGTMIFMPKGLLPS 303 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 315 Length adjustment: 28 Effective length of query: 330 Effective length of database: 287 Effective search space: 94710 Effective search space used: 94710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory