Align 5-aminovalerate transaminase (EC 2.6.1.48) (characterized)
to candidate WP_083763404.1 AMB_RS01605 aspartate aminotransferase family protein
Query= BRENDA::Q9I6M4 (426 letters) >NCBI__GCF_000009985.1:WP_083763404.1 Length = 384 Score = 226 bits (576), Expect = 9e-64 Identities = 148/412 (35%), Positives = 214/412 (51%), Gaps = 55/412 (13%) Query: 29 ERAENSTVWDVEGREYIDFAGGIAVLNTGHLHPKVIAAVQEQLGKLSHTC--FQVLAYEP 86 ER E + ++ +GR Y+DFA G+AV GH HP+++ A+ Q K+ HT ++V E Sbjct: 12 ERGEGAYLFTADGRRYLDFAAGVAVNALGHCHPRLVKALTAQAAKVWHTSNLYRVAGQES 71 Query: 87 YIELAEEIAKRVPGDFPKKTLLVTSGSEAVENAVKIARAATGRAG------VIAFTGAYH 140 AK V F SG+EA+E ++K+AR AG +I GA+H Sbjct: 72 VA------AKLVERSFADTVFFCNSGAEALECSIKMARRHHFAAGNPQRYRIICAEGAFH 125 Query: 141 GRTMMTLGLTGK------VVPYSAGMGLMPGGIFRALAPCELHGVSEDDSIASIERIFKN 194 GRT+ T+ G+ P G +P G AL ASI Sbjct: 126 GRTLATVAAGGQKKHLEGFAPAVDGFDHVPYGNLNALR-------------ASIT----- 167 Query: 195 DAQPQDIAAIIIEPVQGEGGFYVNSKSFMQRLRALCDQHGILLIADEVQTGAGRTGTFFA 254 ++ AAI++EPVQGEGG +++RLRA D+ G+LLI DEVQTG GRTGT FA Sbjct: 168 ----EETAAILVEPVQGEGGIVPGDPDYLRRLRATADEFGLLLIFDEVQTGMGRTGTLFA 223 Query: 255 TEQLGIVPDLTTFAKSVGGGFPISGVAGKAEIMDAIAPGGLGGTYAGSPIACAAALAVLK 314 EQ GI PD+ AK +GGGFP+ + + PG G T+ G+P+A A A VL Sbjct: 224 HEQAGIAPDIMGVAKGLGGGFPVGACLATTKAASGMVPGTHGSTFGGNPLAMAVAGEVLD 283 Query: 315 VFEEEKLLERSQAVGERLKAGLREIQAKHK-VIGDVRGLGSMVAIELFEGGDTHKPAAEL 373 + E LE QA+ L++ + + A+ V+ +VRGLG M+ I+ P E+ Sbjct: 284 IMAEPGFLEHVQAMAALLRSKVEDTAARFPGVVEEVRGLGLMLGIK------PRMPNTEM 337 Query: 374 VSKIVVRAREKGLILLSCGTYYNVIRFLMPVTIPDAQLEKGLAILAECFDEL 425 V+++ E GL+ + G N++R L P+ I DAQ+++ + ILA FDE+ Sbjct: 338 VARLA----EGGLLTVGAGD--NIVRLLPPLIINDAQVDEAVGILARAFDEV 383 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 384 Length adjustment: 31 Effective length of query: 395 Effective length of database: 353 Effective search space: 139435 Effective search space used: 139435 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory