Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate WP_011384263.1 AMB_RS09395 ABC transporter ATP-binding protein
Query= TCDB::Q9KKE1 (275 letters) >NCBI__GCF_000009985.1:WP_011384263.1 Length = 273 Score = 151 bits (382), Expect = 1e-41 Identities = 80/220 (36%), Positives = 125/220 (56%), Gaps = 9/220 (4%) Query: 18 KKALTMVEDGLDKADILSRSGCTVGLNDVSLKIGAGKIFVIMGLSGSGKSTLVRHINRLI 77 +++LT+ + + G + D SL+I G+ ++G SG GKST + + + Sbjct: 7 RRSLTVTRGRIGIQRLSVSFGAHAAVEDFSLEIEPGEFVCLLGPSGCGKSTALNAVAGFL 66 Query: 78 EPTSGEVLFDGDNILDLGAKALRAFRMRRVSMVFQSFALMPHRTVLQNVVYGQRVRGVSK 137 P G V DG + G + MVFQ +L P +TVL+NV +G R++G ++ Sbjct: 67 RPARGRVAVDGVEVTGPGPER---------GMVFQQHSLFPWKTVLENVAFGPRMQGKTR 117 Query: 138 DDAREIGMKWIDTVGLSGYDAKFPHQLSGGMKQRVGLARALAADTDVILMDEAFSALDPL 197 +AR++ +++D VGL G ++P LSGGM QRVG+ARAL V+LMDE F ALD Sbjct: 118 AEARDLAREYLDLVGLGGSAQRYPAALSGGMAQRVGIARALVNHPSVLLMDEPFGALDAQ 177 Query: 198 IRGDMQDQLLQLQRNLAKTIVFITHDLDEALRIGSEIAIL 237 R MQ+ LL+L + T++F+THD+DEAL + + ++ Sbjct: 178 TRSIMQESLLRLWGQIGNTVLFVTHDIDEALFLADRVVVM 217 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 273 Length adjustment: 25 Effective length of query: 250 Effective length of database: 248 Effective search space: 62000 Effective search space used: 62000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory