Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate WP_011383734.1 AMB_RS06730 nitrate ABC transporter ATP-binding protein
Query= SwissProt::P17328 (400 letters) >NCBI__GCF_000009985.1:WP_011383734.1 Length = 452 Score = 159 bits (403), Expect = 1e-43 Identities = 86/193 (44%), Positives = 126/193 (65%), Gaps = 12/193 (6%) Query: 51 IEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAM 110 +EEGEI ++G SGSGKST++R++ LI+ G+V G L K I+M Sbjct: 38 LEEGEIVALLGKSGSGKSTLLRIMAGLIKANGGEVKYRG---------HLMTGPAKGISM 88 Query: 111 VFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQVGLENYAHAYPDELSGGMR 170 VFQSFAL P +TV +N G+E AG+A ER E+A +A+ +GL Y AYP ELSGGMR Sbjct: 89 VFQSFALFPWLTVEENVELGLEAAGVAKAEREERANEAIDLIGLGGYESAYPKELSGGMR 148 Query: 171 QRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQ---RTIVFISHDLDE 227 QRVG ARAL + PD+LL+DE FSALD L ++++L++L + + + I+ +SH+++E Sbjct: 149 QRVGFARALVMRPDVLLLDEPFSALDVLTSETLREDLLELWDERKIPTKGILLVSHNIEE 208 Query: 228 AMRIGDRIAIMQN 240 A+ + DR+ + + Sbjct: 209 AVSMADRVLVFSS 221 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 452 Length adjustment: 32 Effective length of query: 368 Effective length of database: 420 Effective search space: 154560 Effective search space used: 154560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory