Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate WP_011384263.1 AMB_RS09395 ABC transporter ATP-binding protein
Query= SwissProt::P17328 (400 letters) >NCBI__GCF_000009985.1:WP_011384263.1 Length = 273 Score = 155 bits (393), Expect = 1e-42 Identities = 88/222 (39%), Positives = 126/222 (56%), Gaps = 10/222 (4%) Query: 18 PQRAFKYIEKG-LSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNR 76 P R + +G + +++ G V+D SL IE GE ++G SG GKST + + Sbjct: 5 PNRRSLTVTRGRIGIQRLSVSFGAHAAVEDFSLEIEPGEFVCLLGPSGCGKSTALNAVAG 64 Query: 77 LIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGI 136 + P RG+V +DGV++ MVFQ +L P TVL+N AFG + G Sbjct: 65 FLRPARGRVAVDGVEVTGPGPER---------GMVFQQHSLFPWKTVLENVAFGPRMQGK 115 Query: 137 AAQERREKALDALRQVGLENYAHAYPDELSGGMRQRVGLARALAINPDILLMDEAFSALD 196 E R+ A + L VGL A YP LSGGM QRVG+ARAL +P +LLMDE F ALD Sbjct: 116 TRAEARDLAREYLDLVGLGGSAQRYPAALSGGMAQRVGIARALVNHPSVLLMDEPFGALD 175 Query: 197 PLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIM 238 R+ MQ+ L++L + T++F++HD+DEA+ + DR+ +M Sbjct: 176 AQTRSIMQESLLRLWGQIGNTVLFVTHDIDEALFLADRVVVM 217 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 273 Length adjustment: 28 Effective length of query: 372 Effective length of database: 245 Effective search space: 91140 Effective search space used: 91140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory