Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate WP_083763404.1 AMB_RS01605 aspartate aminotransferase family protein
Query= BRENDA::P42588 (459 letters) >NCBI__GCF_000009985.1:WP_083763404.1 Length = 384 Score = 211 bits (536), Expect = 4e-59 Identities = 128/381 (33%), Positives = 202/381 (53%), Gaps = 28/381 (7%) Query: 76 LVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELL-----DPLRAMLA 130 L G+ ++D G + +GH +P +V A+ Q AK H+ L + + A L Sbjct: 19 LFTADGRRYLDFAAGVAVNALGHCHPRLVKALTAQAAKV-WHTSNLYRVAGQESVAAKLV 77 Query: 131 KTLAALTPGKLKYSFFCNSGTESVEAALKLAKAYQSPRG---KFTFIATSGAFHGKSLGA 187 + A T FFCNSG E++E ++K+A+ + G ++ I GAFHG++L Sbjct: 78 ERSFADTV------FFCNSGAEALECSIKMARRHHFAAGNPQRYRIICAEGAFHGRTLAT 131 Query: 188 LSATAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVI 247 ++A + + F P + GF HVP+GN+ A+R ++ E + AA+++EP+QGEGG++ Sbjct: 132 VAAGGQKKHLEGFAPAVDGFDHVPYGNLNALRASITE------ETAAILVEPVQGEGGIV 185 Query: 248 LPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVM 307 P YL +R DEFG L+I DEVQTGMGRTG +FA E + PDI+ +AK LGGG Sbjct: 186 PGDPDYLRRLRATADEFGLLLIFDEVQTGMGRTGTLFAHEQAGIAPDIMGVAKGLGGG-F 244 Query: 308 PIGATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLL 367 P+GA +AT + S + P H +TFGGNPLA A A ++++ E + +L Sbjct: 245 PVGACLATTKAASGMV--PGTHGSTFGGNPLAMAVAGEVLDIMAEPGFLEHVQAMAALLR 302 Query: 368 DGFRQLAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRI 427 A +P +V+E RG G+++ I+ + + +L G +N +R+ Sbjct: 303 SKVEDTAARFPGVVEEVRGLGLMLGIK--PRMPNTEMVARLAEGGLLTVGAGDN--IVRL 358 Query: 428 EPPLTLTIEQCELVIKAARKA 448 PPL + Q + + +A Sbjct: 359 LPPLIINDAQVDEAVGILARA 379 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 384 Length adjustment: 32 Effective length of query: 427 Effective length of database: 352 Effective search space: 150304 Effective search space used: 150304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory