Align TRAP C4-dicarboxylate transport system permease, DctM-2 subunit, component of The 2-ketomonocarboxylate transporter (presented in order of affinity - 2-oxovalerate [highest affinity, KD=0.1 μM], 2-oxoisovalerate, 2-oxobutyrate, 2-oxoisocaproate, 2-oxo-3-methylvalerate, pyruvate [lowest affinity, KD=3 μM]) (characterized)
to candidate WP_011383251.1 AMB_RS04130 TRAP transporter large permease
Query= TCDB::D5ATK1 (611 letters) >NCBI__GCF_000009985.1:WP_011383251.1 Length = 442 Score = 134 bits (337), Expect = 8e-36 Identities = 122/509 (23%), Positives = 208/509 (40%), Gaps = 88/509 (17%) Query: 13 IMFVSLIVFLLLGYPVAFSLAANGLVFFIIGVELAPLSGGSINLDWPLLNAMPERFWGVL 72 I+ + L+V + +G +A LAA G+ L+ G +N LL + + L Sbjct: 13 ILLLMLVVRIHIG--IAMFLAATGIYLV--------LNHGELN---SLLFTLNNLVYARL 59 Query: 73 SNETLLAIPFFTFMGILLEKSGMAEDLLDTIGQLFGPIRGGLAYAVILVGALLAATTGVV 132 SN L IP F MG G+++ L G L G +GGLAYA A A G Sbjct: 60 SNYDLAVIPLFILMGQFATHGGLSKALFHAAGTLIGHFKGGLAYAATAACAAFGAICGSS 119 Query: 133 AASVIAMGLISLPIMLRYGYDRRIASGVIAASGTLAQIIPPSLVLIVLADQLGRSVGDMY 192 A+ MG ++LP + R Y R+A+G +AA GTL +IPPS+ L+V A S+G ++ Sbjct: 120 LATAATMGQVALPELTRRNYSGRLATGTLAAGGTLGILIPPSVPLVVYAVLTQESIGKLF 179 Query: 193 KGALIPGLVLTGLYMLYVLVMSILRPNSMPALPK-EARTLGQGVLSFFVAMGIGIAIFVA 251 A+IPG++ YM + ++ L P + PA + + + + L + + + + V Sbjct: 180 VAAVIPGIIAALGYMAVIRIIVSLDPKAGPASERVSLKEMIKAQLGIIPVLLVFLVVIVG 239 Query: 252 AQHWLAGTGAAKNAGILAASIAVIFVYVMALIDKATGLDRMSHLAQQVIIVLIPPLALIF 311 A A + G A I + +G R L Q V I + Sbjct: 240 IYGGWANPTEAASIGAAACGIIAV----------VSGGMRFKDLKQSVFGTAIATAMIFM 289 Query: 312 LVLGTIFLGIATPTEGGAMGAVGALILSAVKKRLSLEVVREALAATTRLSAFV-MFILLG 370 +++G L AL L+ + L+ V + L + +++LLG Sbjct: 290 VLIGADLLN-------------SALALTQMPAELANWVKNSGMPPVAVLFTIIAIYVLLG 336 Query: 371 ARVFSLTFYGVNGHIWVEHLLVSLPGGETGFLIFVSLLVFFLAFFLDFFELAFIIVPLLV 430 + SL +L+++P + + + LDF+ + Sbjct: 337 CVMDSLAM-----------ILLTIP------------IFYPVVLGLDFYGM--------- 364 Query: 431 APAEALGIDLIWFGVILGVNMQTSFMHPPFGFALFFLRSVAPKVPFLDKVTGKLTEPVKT 490 ++ IWFG++ + ++ +HPP G L+ + +A VP + G L Sbjct: 365 ----SVDDKSIWFGIVALMVVEIGLVHPPVGMNLYVINKIAKDVPLKETAMGVL------ 414 Query: 491 SQIYWGAVPFVCIQIVMIAVVIAFPQLVM 519 PF+ + I V++ FP + + Sbjct: 415 --------PFLASDFIRIVVLVFFPPMAL 435 Lambda K H 0.327 0.146 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 666 Number of extensions: 38 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 611 Length of database: 442 Length adjustment: 35 Effective length of query: 576 Effective length of database: 407 Effective search space: 234432 Effective search space used: 234432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory