GapMind for catabolism of small carbon sources

 

Aligments for a candidate for dctM in Magnetospirillum magneticum AMB-1

Align Alr3027 protein, component of The 2-oxo monocarboxylate transporter (Pernil et al., 2010). Transports pyruvate which is inhibited by various 2-ketoacids (characterized)
to candidate WP_011384964.1 AMB_RS13000 C4-dicarboxylate ABC transporter

Query= TCDB::Q8YSQ7
         (445 letters)



>lcl|NCBI__GCF_000009985.1:WP_011384964.1 AMB_RS13000
           C4-dicarboxylate ABC transporter
          Length = 486

 Score =  503 bits (1296), Expect = e-147
 Identities = 247/444 (55%), Positives = 333/444 (75%), Gaps = 13/444 (2%)

Query: 8   LGPVMFAGALVLLSSGYPVAFSLGGVAILFGLLGIGLGVFDPIFLTAMPQRIFGIMANYT 67
           + P+MFA  +  L  GYPVAF+L    I+FGL+GI LG+ +     A+P+RIFGIM N T
Sbjct: 9   MAPLMFAALVFFLLIGYPVAFALAANGIVFGLVGIELGLLNASLFQALPERIFGIMRNDT 68

Query: 68  LLAIPYFIFMGAMLEKSGIAERLLETMGILLGRLRGGLALAVVLVGALLAATTGVVAATV 127
           LLAIP+F FMG +LE+SG+AE LL+T+G L G +RGGLA AV+ VGALLAATTGVVAA+V
Sbjct: 69  LLAIPFFTFMGLILERSGMAEDLLDTIGQLFGPIRGGLAYAVIFVGALLAATTGVVAASV 128

Query: 128 VAMGLISLPIMLRYGYNKELATGVIAASGTLGQIIPPSVVLVVLGDQLGISVGDLFIGSV 187
           ++MGLISLPIMLRYGY++ +A+GVIAASGTL QIIPPS+VL+++ DQLG SVGD++ G+ 
Sbjct: 129 ISMGLISLPIMLRYGYDRRVASGVIAASGTLAQIIPPSLVLIIMADQLGRSVGDMYAGAF 188

Query: 188 IPGLMMASAFALHVLIVAFIRPDVAPALPAQVREIGGKALGKRVIQVMIPPLILILLVLG 247
           IPG ++   +A  + +V  IRP  APALP + R + G  L  R +  ++PPLILI LVLG
Sbjct: 189 IPGFVLTGLYAGFIFLVTMIRPSFAPALPPEARSLRGMGLLLRTVTCLVPPLILIFLVLG 248

Query: 248 SIFFGFATPTEAGAVGCAGAIALAAANGQFTLESLRQVCDTTLRITSMVVFILIGSTAFS 307
           +IF G ATPTE GA+G AGA+ LA    +     +RQ  DTT +++  VVFIL+GST F 
Sbjct: 249 TIFIGVATPTEGGAMGAAGAMILALMKRKLDWNLMRQAMDTTAKLSCFVVFILVGSTVFG 308

Query: 308 LVFRGLNGDQFMFDVLANLPGGKIGFLFVSMTTVFLLGFFIDFFEIAFIVIPLFVPVAQK 367
           LVFRG+NGD ++  ++++LPGGK+GFL V+   +F+L FF+DFFE+AFI++PL  PVA+K
Sbjct: 309 LVFRGVNGDLWVEHLMSSLPGGKLGFLIVTNVLMFVLAFFLDFFELAFILVPLLGPVAEK 368

Query: 368 LGIDLVWYGVILGANLQTSFLTPPFGFALFYLRGVAP-------------PEVTTSDIYR 414
           +GIDL+W+GV+LG N+QTSF+ PPFGFALFYLR VAP             P++TT  IY 
Sbjct: 369 MGIDLIWFGVLLGVNMQTSFMHPPFGFALFYLRSVAPKTDYIDKITNKLTPKITTGQIYW 428

Query: 415 GVIPFILLQLLVLLLIIIFPGIVS 438
           G +PF+++Q++++ L+I FP +V+
Sbjct: 429 GAVPFVIIQIIMVGLVIAFPDLVT 452


Lambda     K      H
   0.331    0.149    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 692
Number of extensions: 28
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 445
Length of database: 486
Length adjustment: 33
Effective length of query: 412
Effective length of database: 453
Effective search space:   186636
Effective search space used:   186636
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory