Align TRAP dicarboxylate transporter, DctP-2 subunit, component of The 2-ketomonocarboxylate transporter (presented in order of affinity - 2-oxovalerate [highest affinity, KD=0.1 μM], 2-oxoisovalerate, 2-oxobutyrate, 2-oxoisocaproate, 2-oxo-3-methylvalerate, pyruvate [lowest affinity, KD=3 μM]) (characterized)
to candidate WP_011384965.1 AMB_RS13005 ABC transporter substrate-binding protein
Query= TCDB::D5ALT6 (365 letters) >NCBI__GCF_000009985.1:WP_011384965.1 Length = 364 Score = 474 bits (1221), Expect = e-138 Identities = 227/358 (63%), Positives = 267/358 (74%), Gaps = 1/358 (0%) Query: 1 MDRRSFLTKAAIGGAAA-TTLATPALAQSMPKVTWRLTSSFPKSLDTIYGGAEVLSKMVS 59 M RR FLT AA+G AAA TT+A PA+AQSMP++ WRL SSFPKSLDTIYG EVL+K V+ Sbjct: 1 MQRRKFLTGAAVGAAAASTTIAAPAIAQSMPEIKWRLASSFPKSLDTIYGAGEVLAKRVA 60 Query: 60 EASDGNFQIQVFAAAEIVPGLQAADATAAGTVEACHTVGYYYWGKDPAWALGAAVPFGLS 119 EA+DG FQI+VFA EIVPGLQ DA GTVE HTV YYY GKD + A++PFG + Sbjct: 61 EATDGKFQIRVFAGGEIVPGLQVLDAVQNGTVECGHTVSYYYVGKDATFGFDASMPFGAN 120 Query: 120 ARGMNAWQYHGGGIDLYNEFLATQGLIGFPGGNTGAQMGGWFRKEINTVADLSGLKMRVG 179 R N+W YHGGG+ L EF A ++ FP GNTG QMGGWFRKEI TV DL GLK R+G Sbjct: 121 TRQQNSWLYHGGGMALMREFFAKYNMLNFPCGNTGTQMGGWFRKEIKTVEDLKGLKFRIG 180 Query: 180 GFAGKVMEKLGLVPQQVAGGDIYPALEKGTLDATEWVGPYDDEKLGFYKVAPYYYYPGWW 239 G+AGKV+ KLG+VPQQ+AGGD+YPALEKGT+DA EWVGPYDDEKLGF KVAPYYYYPGWW Sbjct: 181 GYAGKVLTKLGVVPQQIAGGDLYPALEKGTIDAAEWVGPYDDEKLGFNKVAPYYYYPGWW 240 Query: 240 EGGPTVHFMFNKAAYEGLPKAYQALLRTACQAEDADMLQKYDYKNPLALKSLVANGAQLR 299 EGGP V + NK +E LPK Y+A+ A + DM KYD NP ALK L+ANG QLR Sbjct: 241 EGGPCVSALVNKNEWEKLPKHYKAVFEAAAAEANLDMSAKYDVLNPPALKRLIANGTQLR 300 Query: 300 PFSQEILEACFNAAQEVYAEMTATNPAFKKIYDSMVAFRADHYLWTQVAEYNYDTFMM 357 PFS++I+ AC+ AAQE YAE A NPAFKK++D A+ A+ W VAE +D FM+ Sbjct: 301 PFSKDIMLACYKAAQETYAEECAANPAFKKVFDHWSAYLAEQRSWFSVAEAGFDNFML 358 Lambda K H 0.319 0.134 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 468 Number of extensions: 20 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 364 Length adjustment: 29 Effective length of query: 336 Effective length of database: 335 Effective search space: 112560 Effective search space used: 112560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory