Align L-rhamnose-1-dehydrogenase; EC 1.1.1.173 (characterized)
to candidate WP_011382728.1 AMB_RS01425 bifunctional aldolase/short-chain dehydrogenase
Query= SwissProt::A3LZU7 (258 letters) >NCBI__GCF_000009985.1:WP_011382728.1 Length = 679 Score = 95.5 bits (236), Expect = 3e-24 Identities = 82/256 (32%), Positives = 123/256 (48%), Gaps = 25/256 (9%) Query: 8 KVVAITGGVTGIGRAIAIEMARNGAKVVVNHLPSEEQAQLAKELKEEISDGENNVLTIPG 67 +VV +TGG +GIG A A A+ GA+V V ++ A+ AK L I Sbjct: 431 QVVVVTGGGSGIGAATAKAFAKEGAEVAVLDRDADAAAKAAKACG-------GKALGIAC 483 Query: 68 DISLPETGRRIVELAVEKFGEINVFVSNAGVCGFREFLEITPETLFQTVNINLNGAFFAI 127 D++ P + R + E+FG ++V VSNAG E+ TL + +N FF Sbjct: 484 DVTDPASVRAAFDRVAERFGGVDVVVSNAGAAWQGAVGEVDDSTLRASFELN----FFGH 539 Query: 128 QAAAQQMVK----QGKGGSIIGISSISALVGGAHQTHYTPTKAGILSLMQSTACALGKYG 183 QA AQ V+ QG GG+++ +S A+ G + Y KA L LM+ A GK G Sbjct: 540 QAVAQNAVRVFKAQGTGGALLFNASKQAVNPGKNFGPYGLPKAATLFLMKQYALDHGKDG 599 Query: 184 IRCNAILPGTISTALNEEDL-------KDPEKRKYMEGRIPLGRVGDPKDIAGPAIFLAS 236 IR NA+ I + L +D+ + ++ YM G + LGR +D+A ++LA Sbjct: 600 IRSNAVNADRIRSGLLTDDMIKSRSSARGLSEQDYMGGNL-LGREVTAEDVADAFVWLAK 658 Query: 237 DMSNYVNGAQLLVDGG 252 ++ V + VDGG Sbjct: 659 --ASKVTACTVTVDGG 672 Lambda K H 0.317 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 679 Length adjustment: 31 Effective length of query: 227 Effective length of database: 648 Effective search space: 147096 Effective search space used: 147096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory