Align L-rhamnose-1-dehydrogenase ( EC 1.1.1.173) (characterized)
to candidate WP_011383322.1 AMB_RS04485 NAD(P)-dependent oxidoreductase
Query= reanno::BFirm:BPHYT_RS28235 (260 letters) >NCBI__GCF_000009985.1:WP_011383322.1 Length = 250 Score = 116 bits (290), Expect = 5e-31 Identities = 88/260 (33%), Positives = 124/260 (47%), Gaps = 26/260 (10%) Query: 3 LKDKVVIVTGGSRGIGRAIAVACAAEGADVAINYWGDNDVSYGRRSAVAEVVAEIEALGR 62 L KV +VTG S GIG AIA AEGA VA+ + R +A +A+ GR Sbjct: 5 LSGKVAVVTGASSGIGHAIAQRFLAEGAKVAV---------FARNAAALADLAK----GR 51 Query: 63 R--VIAIEGNVAARETGQQLVRHTVEAFGKVDVLASNAGICPFHAFLDMPPEVLESTVAV 120 V+A+ G+V ++LV TV+ FG VD++ NAGI F ++ AV Sbjct: 52 EDSVLAVTGDVTCAADLERLVAETVKRFGGVDMVIPNAGIAKVVPFEQSDAAAIDHQFAV 111 Query: 121 NLNGAFYVTQAAAQQMKLQGTGGAIVATSSISALVGGGMQTHYTPTKAGVHSLMQSCAVA 180 N GA + ++ GG+++ ++ VG Y+ +KA + S Q+ A Sbjct: 112 NFTGAVQTVRGFLPHIR---QGGSVLFVTTFLTQVGFPGLAIYSASKAALKSFSQTLAAE 168 Query: 181 LGPYGIRCNSVMPGTIAT------DLNAQDLADEAKKAYFEKRIPLGRLGRPEDVADCVT 234 L P GIR NSV PG I T L A L +A R+ G G P D+A Sbjct: 169 LAPKGIRVNSVAPGPIGTPIWGSIGLPADVL--QAVATQVTARLMPGAFGEPGDIAATAA 226 Query: 235 FLASDRARYVTGAALLVDGG 254 FL SD+A+ + G ++VDGG Sbjct: 227 FLCSDQAKNIWGQEIVVDGG 246 Lambda K H 0.319 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 250 Length adjustment: 24 Effective length of query: 236 Effective length of database: 226 Effective search space: 53336 Effective search space used: 53336 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory