Align 2-keto-3-deoxy-L-rhamnonate aldolase; KDR aldolase; EC 4.1.2.53; 2-dehydro-3-deoxyrhamnonate aldolase (uncharacterized)
to candidate WP_011383244.1 AMB_RS04095 4-hydroxy-2-oxoheptanedioate aldolase
Query= curated2:B5R262 (267 letters) >NCBI__GCF_000009985.1:WP_011383244.1 Length = 267 Score = 289 bits (740), Expect = 4e-83 Identities = 142/261 (54%), Positives = 184/261 (70%) Query: 6 SNPFKEGLRKGDTQIGLWLSSTTSYMAEIAATSGYDWLLIDGEHAPNTVQDLYHQLQAIA 65 +NPFK L +G QIGLW+ Y AEI A +G+DWLLIDGEHAPN V L QLQA+A Sbjct: 5 ANPFKRALAEGRPQIGLWVGLANPYTAEICAGAGFDWLLIDGEHAPNDVPGLLAQLQAVA 64 Query: 66 PYASQPVIRPIEGSKALIKQVLDIGAQTLLIPMVDTAEQARQVVSATRYPPLGQRGVGAS 125 PY S P++RP+ G ALIKQ+LDIGAQTLL+PM+DT EQA V+A YPP G RGVGA+ Sbjct: 65 PYPSHPIVRPVIGDTALIKQLLDIGAQTLLVPMIDTPEQAAATVAAMHYPPRGVRGVGAA 124 Query: 126 VARAARWGRIDNYMAQANESLCLLVQVESKVALENLDAILEVEGIDGVFIGPADLSASLG 185 +ARA+RWGRI +Y+ A++ LCLL+Q+E+ L NL+AI +G+DG+FIGPADL+ASLG Sbjct: 125 LARASRWGRIGDYLKTASDELCLLLQIETVTGLRNLEAIATTDGVDGIFIGPADLAASLG 184 Query: 186 YPDNAGHPEVQRIIESCIYRIRAAGKAAGFLAVDPAMAQKCLAWGANFVAVGVDTMLYTE 245 + HPEVQ IE + ++ G +G LA D +A+K LA GA FVAVG+DTM+ + Sbjct: 185 HLGAPSHPEVQAEIEKALAMLKRLGVPSGILAADETLARKFLAAGATFVAVGIDTMVLSR 244 Query: 246 ALDSRLAMFKSVQSVSTAKRS 266 AL + A +K V + R+ Sbjct: 245 ALSALAATYKDVAPPAQTDRA 265 Lambda K H 0.318 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 267 Length adjustment: 25 Effective length of query: 242 Effective length of database: 242 Effective search space: 58564 Effective search space used: 58564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory