GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rhaD in Magnetospirillum magneticum AMB-1

Align bifunctional L-rhamnulose 1-phosphate aldolase/lactaldehyde dehydrogenase (EC 4.1.2.19; EC 1.2.1.22) (characterized)
to candidate WP_011382728.1 AMB_RS01425 bifunctional aldolase/short-chain dehydrogenase

Query= metacyc::BSU31220-MONOMER
         (689 letters)



>lcl|NCBI__GCF_000009985.1:WP_011382728.1 AMB_RS01425 bifunctional
           aldolase/short-chain dehydrogenase
          Length = 679

 Score =  371 bits (952), Expect = e-107
 Identities = 229/694 (32%), Positives = 358/694 (51%), Gaps = 35/694 (5%)

Query: 2   VKHIWDSERAAQL-----PKGVEE----LVYRSNLIGSDRTVCNWGGGNTSMKTTEKDFR 52
           +K +W    A        P+GV       VY + L+G D  +   GGGNTS KTT  D  
Sbjct: 1   MKSLWSDADAESFVTRYAPEGVNRDLALRVYTTRLLGGDPRLVLHGGGNTSCKTTVTDLL 60

Query: 53  GREIEVMWVKGSGSDLATMKAHNFSGLKLDDIRPLIKRDQMPDEEMVDYLSHCMIDSKHP 112
           G  +EV+ VKGSG D+  ++      ++L  +  L + D + DE+MVDY    +++S  P
Sbjct: 61  GETVEVLCVKGSGWDMGDIEPAGLPAVRLAPLLKLRRLDSLSDEDMVDYQRGNLMNSASP 120

Query: 113 RPSIETLLHAFLPYKHVDHTHPDAIISICCADNGKQIAEDIYGNRFVWVPYVRPGFTLSK 172
            PS+ETLLH FLP+K +DHTH  A++S+    +G+ +A ++YG R  +VPY+ PGF L+K
Sbjct: 121 NPSVETLLHGFLPHKFIDHTHSTAVLSLVDQPDGEALAREVYGTRMGYVPYIMPGFALAK 180

Query: 173 MIAEGVANNPHAELVLMEKHGLVTWGETSETCYQKTISIIQEAEQYINDRINQHEVFGGK 232
             AE    +P  E +++ KHG+ T+ + + T Y+  I ++  AEQ +           G 
Sbjct: 181 KAAEIYEQDPTVEGLILVKHGIFTFADNARTAYELMIEMVTLAEQRLEKGRKPLVAATGL 240

Query: 233 RYQPLPEDKRKQILAGIMPVIRGAVSE-EKKMILSYDDHDDVLEFVNSVQAPALSQIGAA 291
              P P       LA + P++RG ++   K+ IL +   + +  +V+  +    SQ G  
Sbjct: 241 PKDPAP-------LAEVAPILRGLLANGPKRRILDFRTSNAIRAYVDGAEIGRYSQQGVV 293

Query: 292 CPDHLVHTKRVPLYIDWNPETQDVHKLADLIKSGVETFTSEYQAYFTRNQQDGDQI---F 348
            PDH + TK  P+ +   PE     + A+  ++ +E+F ++Y AYF+RN Q    I    
Sbjct: 294 TPDHTIRTKNWPVVLP-APEAGKTAEWAEAAQAAIESFEAKYHAYFSRNNQRLGNIKTEL 352

Query: 349 ESAPRVILIPGIGMVNTGKSYAMSKVSGALYRRAIAVMKGATALGQFVSLHENESYHVEY 408
           +  P V L+PG+G+   G S   + ++  +    +  +  A A+G+F  + E + + +EY
Sbjct: 353 DPKPCVALVPGLGLFGIGASAKDAAIAADIAVNTVESITDAEAIGRFEPVGEADLFDLEY 412

Query: 409 WPLELYKLTLAPPEAEFSRKVALITGGAGGIGSAACRRFAAEGGHVIVADLNIEGAQKIA 468
           W LE  KL  A  E   +R+V ++TGG  GIG+A  + FA EG  V V D + + A K A
Sbjct: 413 WSLEQAKLGKA-AEKPLARQVVVVTGGGSGIGAATAKAFAKEGAEVAVLDRDADAAAKAA 471

Query: 469 GEINDAYGKGRAMAVKMDVTKEEDVQSAFERAALAYGGIDIVVNNAGLATSSPFDETSLK 528
                    G+A+ +  DVT    V++AF+R A  +GG+D+VV+NAG A      E    
Sbjct: 472 KACG-----GKALGIACDVTDPASVRAAFDRVAERFGGVDVVVSNAGAAWQGAVGEVDDS 526

Query: 529 EWNLNMNVLGTGYFLVAREAFKQMKHQNRGGSMVFVGSKNSVYAGKNASAYSSVKALETH 588
               +  +   G+  VA+ A +  K Q  GG+++F  SK +V  GKN   Y   KA    
Sbjct: 527 TLRASFELNFFGHQAVAQNAVRVFKAQGTGGALLFNASKQAVNPGKNFGPYGLPKAATLF 586

Query: 589 LARCIAAEGGEFGIRVNSVLPDAVLQGSAIWGSSWREERAAAYGIEPDQLEEHYRKRTAL 648
           L +  A + G+ GIR N+V  D +  G  +      + R++A G+     E+ Y     L
Sbjct: 587 LMKQYALDHGKDGIRSNAVNADRIRSG--LLTDDMIKSRSSARGLS----EQDYMGGNLL 640

Query: 649 LVNIYPEDIAEAIAFFASSKAEKTTGCMITVDGG 682
              +  ED+A+A  + A  KA K T C +TVDGG
Sbjct: 641 GREVTAEDVADAFVWLA--KASKVTACTVTVDGG 672


Lambda     K      H
   0.317    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 967
Number of extensions: 39
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 689
Length of database: 679
Length adjustment: 39
Effective length of query: 650
Effective length of database: 640
Effective search space:   416000
Effective search space used:   416000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory