Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_011384082.1 AMB_RS08465 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000009985.1:WP_011384082.1 Length = 253 Score = 238 bits (608), Expect = 7e-68 Identities = 112/251 (44%), Positives = 171/251 (68%) Query: 9 VLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFEL 68 +LKV +SK FGG+ A+ D+ +++ G ++ +IGPNGAGKTT FN+ITG+YTP +G Sbjct: 3 LLKVEKLSKEFGGVHAVEDLTFSVEAGHIHSIIGPNGAGKTTLFNLITGVYTPSSGRVLF 62 Query: 69 AGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKGFK 128 + +E+A+ G++RTFQN+++F M A+ENVMVG H+ ++ R Sbjct: 63 QDRLVSGMKPYELAELGMSRTFQNLQIFFNMQAIENVMVGHHLHLDRRFLPSLLRLPKVT 122 Query: 129 AEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAAGM 188 + + L+++VG+GK+ D A ++ YG +RLEIARALA P+L+ LDEPAAG+ Sbjct: 123 RRDRECREYCAGLMEFVGLGKYLDADAASMPYGALKRLEIARALAAQPKLLLLDEPAAGL 182 Query: 189 NATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQKNE 248 NATE ++ E+I ++ T++L+EHD+K+VMG+ D++T LDYG+++AEG PAEV+ N Sbjct: 183 NATESREIDEVIKKVATTGVTVVLVEHDMKMVMGISDQITALDYGRKLAEGTPAEVRANP 242 Query: 249 KVIEAYLGTGG 259 +V+ AYLGT G Sbjct: 243 EVVSAYLGTHG 253 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 253 Length adjustment: 24 Effective length of query: 236 Effective length of database: 229 Effective search space: 54044 Effective search space used: 54044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory