Align sorbitol dehydrogenase, D-fructose forming (EC 1.1.1.14) (characterized)
to candidate WP_011383322.1 AMB_RS04485 NAD(P)-dependent oxidoreductase
Query= reanno::BFirm:BPHYT_RS16120 (260 letters) >NCBI__GCF_000009985.1:WP_011383322.1 Length = 250 Score = 134 bits (338), Expect = 1e-36 Identities = 92/260 (35%), Positives = 139/260 (53%), Gaps = 18/260 (6%) Query: 1 MAARLQDKVAILTGAASGIGEAVARRYLDEGARCVLVDVKPADSFGDSLRATYGDRVLTV 60 M + L KVA++TGA+SGIG A+A+R+L EGA+ V V + A + D + D VL V Sbjct: 1 MTSSLSGKVAVVTGASSGIGHAIAQRFLAEGAK-VAVFARNAAALADLAKGRE-DSVLAV 58 Query: 61 SADVTRRDDIQRIVASTLERFGQIDILFNNAALFDMRPILEESWDVFDRLFAVNVKGMFF 120 + DVT D++R+VA T++RFG +D++ NA + + P + D FAVN G Sbjct: 59 TGDVTCAADLERLVAETVKRFGGVDMVIPNAGIAKVVPFEQSDAAAIDHQFAVNFTG--- 115 Query: 121 LMQAVAQKMVEQGCGGKIINMSSQAGRRGEALVSHYCATKAAVLSYTQSAALALAPHKIN 180 +Q V + GG ++ +++ + G ++ Y A+KAA+ S++Q+ A LAP I Sbjct: 116 AVQTVRGFLPHIRQGGSVLFVTTFLTQVGFPGLAIYSASKAALKSFSQTLAAELAPKGIR 175 Query: 181 VNGIAPGVVDTPMWNEV----DALFARYENRPLGEKKRLVGEAVPLGRMGVPDDLTGAAL 236 VN +APG + TP+W + D L A ++ +P G G P D+ A Sbjct: 176 VNSVAPGPIGTPIWGSIGLPADVLQA--------VATQVTARLMP-GAFGEPGDIAATAA 226 Query: 237 FLASADADYITAQTLNVDGG 256 FL S A I Q + VDGG Sbjct: 227 FLCSDQAKNIWGQEIVVDGG 246 Lambda K H 0.321 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 250 Length adjustment: 24 Effective length of query: 236 Effective length of database: 226 Effective search space: 53336 Effective search space used: 53336 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory